KEGG   Halorubrum sp. BOL3-1: EKH57_15295Help
Entry
EKH57_15295       CDS       T05834                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
halb  Halorubrum sp. BOL3-1
Pathway
halb00790  Folate biosynthesis
halb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:halb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EKH57_15295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:halb04147]
    EKH57_15295
Enzymes [BR:halb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     EKH57_15295
Exosome [BR:halb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EKH57_15295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a Frigida
Motif
Other DBs
NCBI-ProteinID: QAU13969
UniProt: A0A410TT64
Position
complement(2940102..2940452)
Genome map
AA seq 116 aa AA seqDB search
MASSLAEEPCEACTSDDEPLIEKEYIKYLNKINNVWEVIDNHHLEGEYPFEDFRDALEFT
YEIGELAEEEWHHPDIQLQWGEVKVEMWTHKIDGLHKTDFVMAARMDQIHEEYAPD
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggcatcatcacttgccgaggaaccgtgtgaggcctgtacatcagatgacgagccactc
atagagaaagagtatatcaagtacctcaataaaattaataatgtctgggaagttatagac
aatcatcatctggaaggagagtatccgttcgaggatttccgtgatgcacttgagttcacg
tacgaaatcggagagcttgccgaagaggagtggcatcacccggacatacaacttcaatgg
ggggaagtaaaagttgaaatgtggacccacaaaattgatggactacataagactgatttc
gtaatggcagctcgcatggatcagattcacgaagaatacgctccggattga

DBGET integrated database retrieval system