KEGG   Halorubrum sp. BOL3-1: EKH57_16600Help
Entry
EKH57_16600       CDS       T05834                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
halb  Halorubrum sp. BOL3-1
Brite
KEGG Orthology (KO) [BR:halb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    EKH57_16600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: QAU14164
UniProt: A0A410TTN2
Position
complement(3230442..3231617)
Genome map
AA seq 391 aa AA seqDB search
MDPVLFALFVATALASLFMAWVIGAGSSGATPFAPAVGANAIGTMRAALLVGVFGFVGAV
TQGGNVSEAVGSGLVGGMSMPVAGVILVLVLGAGLMAVGIVTGYPIATAFTVTGAVIGVG
LALGGTPVWSKYQQIAAVWVLTPFVGGGIAYAIASLLPRPDVPERYSIPVLVGLVSAVLV
NIEFGFLGGETSAGTLREVGQQILAVDGRASGFVVTGGVAVGVAAVVWWDVGRDQHGGLQ
RVLLALGSLVAFSAGGSQVGLAVGPLIPLLKDVETVSMVAVLVGGGLGMLAGSWMGAPRM
IKSLAQDYSSLGPRRAISALVPSFLIAQLAVLLGVPVSFNEIVVSAIIGSGAAVGGWNAV
DARKIGMTLGAWAGSFVLSFVLAYAAGAMVM
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgttctcttcgccctctttgtggctacagcgctcgccagtctgttcatggcg
tgggtcatcggcgccggatcgagcggtgccactccgttcgctcctgctgtcggagcgaac
gctatcgggacgatgcgagccgcgctcctggtcggggttttcgggttcgtcggcgccgtc
acgcagggcgggaacgtctcggaagccgttggaagtggactcgtcggtgggatgagcatg
cccgtcgctggggtcatcctcgtgctggtgttgggtgccggcctgatggcggtcggcatc
gtcaccgggtatccgatcgcgaccgcgttcaccgtgaccggcgccgtcatcggtgtcggc
ctcgccctcggtgggacgccggtctggtcgaagtatcagcagatcgccgccgtctgggtg
ttgacgccgttcgtgggtggcgggatcgcgtacgcaatcgcgagcctcctcccgcggcct
gacgtccctgaacggtacagtatccccgtcctcgtcgggctggtcagcgctgttctcgtg
aacatcgagttcggttttctcggtggggaaacctccgcgggaacccttcgagaagtcgga
cagcagatactggcagtcgacggccgtgcgtcggggttcgtcgtgactggtggtgtcgcc
gtgggtgtcgctgccgtcgtctggtgggacgtcggtcgggaccaacatggagggctacag
cgcgtgctgctcgcgctcggctcgctcgtggcgttctccgctggcggtagccaggtcgga
ctcgcagtcgggcccctgattccactcctcaaggatgtcgagacggtgtcgatggttgca
gtactggtcggcggtggcttggggatgctcgcgggttcgtggatgggggctccccggatg
atcaagtcgctcgcgcaggactactcgtcgctggggccgcgacgcgccatctccgcgctc
gtcccgtcgttcctgatcgcacagctggccgtcctgctaggggttcccgtctcgttcaac
gagatcgtcgtcagcgcgatcatcgggagtggcgcggcagtcggcgggtggaacgccgtc
gacgcccggaaaataggcatgacactcggagcgtgggcgggttcgttcgtactctcgttc
gttctcgcatacgcggcgggcgctatggtcatgtag

DBGET integrated database retrieval system