KEGG   Halodesulfurarchaeum formicicum HTSR1: HTSR_0073
Entry
HTSR_0073         CDS       T04517                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
halh  Halodesulfurarchaeum formicicum HTSR1
Brite
KEGG Orthology (KO) [BR:halh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HTSR_0073
SSDB
Motif
Pfam: PHO4
Other DBs
NCBI-ProteinID: AOW79283
UniProt: A0A1D8S1R8
Position
complement(74361..75530)
AA seq 389 aa
MSGGALLTLAVASLASLFMAWAIGAGSSGSTPFAPAVGANAISVMRAGFLVGILGFAGAA
LQGANVSETVGTGLIQSVTLTPAAVVTVLAIAATLVASGVFLGYPIATAFTVTGAVVGVG
LALGGAPAWAAYYEIVGLWAAVPFVGGGVAFATARLLRSVDRDQLTVPALGALVGVVVAN
IRFDILGGDGGQSIAESIAGLGEFGSAGVGLATVGLGLLVALVLRWDVGKRPIAGMRHFL
VAMGGLVAFSAGGSQVGLAVGPLIPLLGDSIPLSMVLVGGGLGLLVGSWTGAPRMIKAIA
QDYSSLGPRRSIAALIPSFVLAQTAVLLGVPVSFNEIVVSAIMGSGLAVEGREGVSAAKM
GYTVLAWVGSLVLAIVVGYGGFRLVSLLF
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgagtggcggcgccctcctgaccctcgcggtcgcctcgctggcgagtctcttcatggcg
tgggctatcggggccggatcgagcggctccacgcccttcgccccggcagtcggagcaaac
gccatctcggtgatgcgggccgggttcctcgtcgggattctgggctttgccggcgcagcc
ctccagggcgcaaacgtctccgagacggtcggaacgggattgattcagagcgtcacactg
acaccggctgccgtggtgaccgtgctcgccatcgccgccacgctggtcgcgtcgggcgtg
ttcctgggctatccgatcgcgacggcgtttaccgtcacgggagccgtggtcggggtcggc
ctcgcgctgggcggtgcgcccgcctgggcggcctactacgagatcgtcggactctgggcc
gccgtccccttcgtcggtggtggggtcgcgttcgcgaccgcgagactcctccggtcggtc
gatcgtgatcagctgacggtgccggccctcggcgcgctcgtgggggtcgtcgtcgcgaac
attcgttttgacatcctcgggggcgacgggggccagtcgatcgccgagagcatcgccgga
ctcggtgagttcggctcggccggcgtcggcctggcgaccgtcggcctggggctcctcgtg
gccctggtccttcggtgggacgtggggaagcgcccgatcgccggcatgcgacacttcctg
gtcgccatgggtgggttggtcgcgttctcggccgggggaagccaggtcgggctggccgtc
gggccgctcatcccgcttttgggtgactcgattccgctctcgatggtgctggtgggtggc
gggctcgggctgctcgtgggctcctggaccggcgcgccgcggatgatcaaggccatcgcc
caggactactcctcgctgggcccgcggcgctcgatcgcggcgctgatcccctccttcgtg
ctggcccagacggcggtcctgctgggcgtgccagtctcgttcaacgagatcgtcgtcagc
gcgattatgggcagcggcctggccgtggagggccgggagggggtgagtgcggcgaaaatg
gggtatacggtcctcgcctgggtcggctcgctcgtgctggcgatcgtcgtgggttatggc
gggttcaggctcgtctccctgctgttctga

DBGET integrated database retrieval system