KEGG   Halodesulfurarchaeum formicicum HTSR1: HTSR_0368Help
Entry
HTSR_0368         CDS       T04517                                 

Definition
(GenBank) sodium/hydrogen exchanger
  KO
K03455  monovalent cation:H+ antiporter-2, CPA2 family
Organism
halh  Halodesulfurarchaeum formicicum HTSR1
Brite
KEGG Orthology (KO) [BR:halh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HTSR_0368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger
Motif
Other DBs
NCBI-ProteinID: AOW79568
UniProt: A0A1D8S2H9
Position
352475..353674
Genome map
AA seq 399 aa AA seqDB search
MASETALLELGLLFAAVGLVGALATRIDQSVIPFYILAGMVLNPFVAGRVAPISLETTPF
VELGAEVGIVLLLLFLGLEFNLDRLLADRARISAAGAIDFAINFGVGLLLGYVLFRAVLP
AFLIAGAVYISSSAIISKSLIDLGWIANDEASPILGTLVAEDLLIALYLVVASAMLAGGS
DLAGTVQSMGVAVGFMLGLLVVVHYGTPVFEALLETNSREFLVLRALGLVVPIAGLGLLL
GVSEAVAAFFVGMAFSATGHVSRVETLLEPVRDVFAAIFFFWIGLVTDPLLLGEVLGLIV
LAVLLTTPTKLVSGYLGGRIYGLNPRRSTRVALGMTTRGEFTLIIAALALSGAGGVLSTD
LAETIYAFAVGYVLVMSLLGTTLMQYATPIENAVSRRFA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtgagacggccctgcttgagcttgggctcctgttcgccgccgtcggactcgtc
ggggcgcttgcgacccggatcgaccagtcggtcatcccgttttacatcctcgccgggatg
gtcctcaaccccttcgtcgcgggccgagtcgccccgatctccctggagaccacgccattc
gtcgaactcggcgcggaagtggggatcgtgctcctcctgcttttcctgggcctggagttc
aatctggatcgactgctggccgatcgggcccgaataagtgcggccggcgcgatcgacttc
gcgatcaatttcggcgtgggactgttgctggggtatgtcctctttcgggccgtcctgccg
gcgttcctgatcgccggtgcggtctacatctcctcctcggcgatcatctcgaagtcgctg
atcgacctcgggtggatcgccaacgacgaggccagcccgatactgggcaccctggtcgcc
gaggacctcctgatcgcactctatctcgtggtggcatccgcgatgctggccggtgggagt
gatctcgcggggactgtccagtcgatgggggtcgccgtgggcttcatgctgggcttgctg
gtcgtcgtccactacggaacgccggtgttcgaggcgctgctcgaaacgaattccagggag
tttctcgtgcttcgggcgcttggactcgtggtgcccatcgccggactcgggctcctactg
ggcgtgagcgaggccgtcgcggccttcttcgttgggatggcgttctcagcgaccgggcac
gtctcgcgggtggagaccctgctcgaaccggttcgggacgttttcgccgcgatattcttc
ttctggatcggcctggtgaccgacccgctcctgctgggggaggtcctcggcctgatcgtc
ctggccgtcctcctgaccaccccaacgaaactcgtcagtgggtatctggggggccggatc
tacgggttgaacccccgtcggtcgactcgggttgccctgggcatgacgacccggggcgag
ttcacgctcatcatcgccgcgctcgcactctccggggcgggcggtgtgctgtcgaccgac
ctcgcggagacgatctatgccttcgcggtggggtacgtgcttgtgatgagcctgctcgga
acgaccttgatgcagtatgccacaccgatcgagaatgcggtcagtcggcggtttgcctga

DBGET integrated database retrieval system