KEGG   Halodesulfurarchaeum formicicum HTSR1: HTSR_0454Help
Entry
HTSR_0454         CDS       T04517                                 

Definition
(GenBank) sodium-dependent phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
halh  Halodesulfurarchaeum formicicum HTSR1
Brite
KEGG Orthology (KO) [BR:halh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HTSR_0454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AOW79654
UniProt: A0A1D8S2R3
Position
complement(436222..437472)
Genome map
AA seq 416 aa AA seqDB search
MLILDTKERYRQAHTFLFGKVAYPAPSYKTAINRLSMSSVIGIVSVALVASLFMSFTVGA
NSNSAPIAPAVGANALSTLRGALLVGLVAGLGAIAQGGSISETIGHGLVTGVTITPLAAT
ATLLTAATLITIGNSRGYPIPSAFTVTGAAIGAGVALGGGFAAGTYAKILGFWFAIPVVE
GILAYGLAWLLLDERVSDEVSIPLLAGGVGYALANIQLSFLPAPQSEQGSIAGVITRQFD
VTLTAVGEAGVVIVGSVIGLLTVAVVYWQLRRDVTTGINRMLVGLALVVVFTSGGSQVGL
ATGPLESVFESSLGLPSVYLLGLGGLGILLGGWFRSPRLIQAVAREYAALGPKRSIAAFI
PAFLIAQAAIALGYPISFNKVMISSIVGAGLVSGSSKSRGYQPRKQGTRSGPGSPR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
ttgttgatccttgatacaaaagaacgctatcgacaggcacatacgtttctgttcgggaaa
gtggcgtatccggctccgagttacaagacagccataaaccggttatccatgtcttcagta
atcgggatcgtctctgtcgcgctcgttgcatcgctttttatgtccttcaccgtcggggca
aacagcaactctgctccgattgcgccagccgtcggggcgaatgcgttgtcgacgcttcga
ggggcactattggtcggcctcgtcgccggtctcggtgccattgcacagggtggcagtatc
tctgagacgatcggccacgggttggtgaccggcgtgacgattaccccactggccgccacg
gcgacgctgcttacggcagccacactcatcaccatcgggaactcacgcggctaccccatc
ccctccgcgttcacggtgacgggagcggcaattggtgcgggtgtcgcgctgggcgggggt
tttgcagctgggacgtacgccaaaattctgggattctggtttgcgattccggtcgtcgag
ggcatcctcgcgtacggtctcgcgtggctgttgctagacgagcgagtctcagatgaggtg
agtattccgctgctcgccggcggtgtcggctacgcacttgccaacatccaattgtcgttt
ctcccggcgccccagagcgagcaagggtcgatcgcgggcgtcatcacccgccagttcgac
gtcacgttgacggcagttggcgaagccggggtcgtcattgtcgggagcgtgatcggtctt
ctgacggtcgcagtagtctactggcaactccggcgtgatgtcacgaccggaatcaaccgg
atgctggtcggacttgccctcgtcgttgtattcaccagcggcggatcgcaggttggtctc
gccaccgggccactggaatccgtcttcgagtcctcgctcggtctcccctcagtatacttg
ctcggacttgggggccttggaattctcctcggtggctggttccggtcaccacgtcttatt
caggccgtggcccgggagtacgccgcactcggtccaaaacgctcgatcgccgcgttcatt
cccgcgtttctcatcgctcaggctgcaatcgctctcggctaccccatctcgttcaacaag
gtgatgatttccagtatcgtcggggctggactggtcagtgggtcgtcgaaatctaggggg
tatcagccgcgaaaacagggtacacggtcggggcctggatcgcctcgatga

DBGET integrated database retrieval system