KEGG   Halodesulfurarchaeum formicicum HTSR1: HTSR_1161Help
Entry
HTSR_1161         CDS       T04517                                 

Gene name
rbcL
Definition
(GenBank) ribulose-bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
halh  Halodesulfurarchaeum formicicum HTSR1
Pathway
halh00630  Glyoxylate and dicarboxylate metabolism
halh01100  Metabolic pathways
halh01110  Biosynthesis of secondary metabolites
halh01120  Microbial metabolism in diverse environments
halh01130  Biosynthesis of antibiotics
halh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:halh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HTSR_1161 (rbcL)
Enzymes [BR:halh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     HTSR_1161 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AOW80341
UniProt: A0A1D8S4Q5
Position
complement(1097392..1098639)
Genome map
AA seq 415 aa AA seqDB search
MTGIAYADFVDTDYQPAPEELVCDFAIEPASGLSMEDAAGRVASESSNGTWAALAVGDDF
TDVGATAFEIGDGTIRVAYPETLFEFGNMPQALSCVAGNIMGMKAVDSIRLQDCSWPADL
ARSFRGPQFGSAVKEAFLDAEDRPALATVPKPKVGLSTKRHAEIGYEAWTGGIDLLKDDE
NLTDQSFNSFADRVTESFEMRDRAEEETGDRKDYLVNITADVETMKERADFVADQGGNFV
MVDVITTGWGAVQSVREHTEKRGLAIHAHRAMHAAFDRLSHHGVSMRVLAQIARLTGVDH
IHTGTANLGKLENEDTAGINEWLQSDLHGMNDVLPVASGGLHPGTVEPLLDALGTDLIVQ
AGGGIHGHPDGTHAGAKALRQAVDAYMAGKSVTEAGESHDELGRALEEWGAETPI
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggattgcctacgcggacttcgtggatacggactaccagccagcgcccgaggaa
ctcgtctgtgattttgccatcgaacccgcgtcggggttgtcgatggaagacgcagccggg
cgtgtcgcctcggaaagttccaatggaacctgggccgcactggcggtcggcgacgacttc
accgacgtgggcgcgacagccttcgagatcggtgacggaacgattcgtgtcgcctacccc
gagacgctgttcgagttcggaaacatgccccaggccctctcctgtgtcgcgggcaacatt
atggggatgaaggccgtggactcgattcgcctccaggactgttcgtggccggccgacttg
gccaggtccttcaggggcccccagttcggttcggccgtcaaagaagcgttcctcgacgcc
gaggaccggcccgcactggcgacggtccccaagccgaaagttgggctctcgacgaagcgc
cacgccgagatcggctacgaggcctggaccggcggcatcgacctgctgaaagacgacgag
aacctgaccgaccagtccttcaacagctttgccgaccgggtcaccgagagcttcgagatg
cgggatcgggcagaggaggagaccggagaccgcaaggattacctggtaaacatcaccgcc
gacgtcgagacgatgaaagagcgggccgacttcgtggccgaccagggcgggaacttcgtc
atggttgatgtcatcaccaccggctggggcgcggtccagtcggtccgggagcacaccgaa
aagcgcgggctcgcgatccacgctcaccgggcgatgcacgcggccttcgatcggctctcc
caccacggcgtctcgatgcgcgtgctcgcccagatcgctcgcctcacgggtgtcgatcac
attcacaccgggacggcgaacctgggaaaactcgaaaacgaggacacggcgggcatcaac
gagtggctacaatccgacctgcacgggatgaacgacgtcctcccggtcgcgtccggcggc
ctccaccctggcacggtcgaaccactcctggacgcgttgggcacggacctcatcgtccag
gctggcggtggcatccacggtcatcccgacgggactcacgccggcgcgaaagcgctccgc
caggcggtcgacgcctacatggccggcaagtcagtcacggaggcgggcgagagccacgac
gaactcggccgcgcactcgaggagtggggcgcagagacgcctatctga

DBGET integrated database retrieval system