KEGG   Halodesulfurarchaeum formicicum HTSR1: HTSR_1708Help
Entry
HTSR_1708         CDS       T04517                                 

Definition
(GenBank) Na+/proline symporter
  KO
K03307  solute:Na+ symporter, SSS family
Organism
halh  Halodesulfurarchaeum formicicum HTSR1
Brite
KEGG Orthology (KO) [BR:halh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HTSR_1708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-ProteinID: AOW80878
UniProt: A0A1D8S6B4
Position
complement(1625656..1627155)
Genome map
AA seq 499 aa AA seqDB search
MVESDTVLILAIIAAYLAGTLLIGYLAWRVLESDVGDLFTASRSLGLVATAMGIFGTQVT
AFGMMGAPGAAYGLGYSAYGYIVGMAQFMAAAAFFVIGYRVWLLAEAFDHVTPVHFFGDR
FESYMPRFVISIAQIIYEIQYIVIGGIGAGIIFEVVTDGFIPYWLGALIILFITTWVAYA
GGQRGSAWTNIFQGALMLAVLVPMMYIVYNALGGGQAILDQLSPQMISLGGAAVQDPKVW
IPFSLIATGMSNGVIAHVLVKNMSADSPKTIKRNTYIYPVLVGVLFFMTISLGVWGSIAL
PGLEGTAVDRILPALAEMYAPTWMVGLIAAGIFAAIMTSWDGMLLATSSMFSDDIIKPIA
KMQGYELSTQWENRFSKFFILVVALVTYLLVLARPDTILAVGVFAFTGFATLVPSYFAAL
YWKGTTSTGVVASVVITTPIVALWAFEVLPAWTTFGFHYSAPSLLLASALVVVVSLLSSP
PSKEIVEQNFDVFDRVFHD
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaatccgacaccgtcctgattctcgccatcatcgcggcctacctggccgggacg
cttctcatcgggtatctcgcctggcgagtcctcgaatcggacgtcggtgacctgttcacc
gcctcgcgaagtctggggctcgtggccacggcgatggggattttcgggacccaggtaacc
gctttcgggatgatgggggctccgggagccgcctacggactcgggtactccgcgtacggg
tacatcgttggaatggcccagttcatggccgcggcggccttcttcgtgatcggctatcgc
gtctggctgctcgccgaagcgttcgatcacgtcacgccggtgcacttcttcggtgaccga
ttcgagtcctacatgccgcgttttgtcatctcgatcgcccagatcatctacgagatccag
tacatcgtgatcggtggcatcggggccgggatcatcttcgaagtcgtgaccgacgggttc
atcccctactggctcggcgcgttgatcatcctgttcatcacgacctgggtggcttacgcc
ggcgggcagcggggcagcgcctggacgaacatcttccagggggcgctcatgctcgcggtg
ctggtcccgatgatgtatatcgtctacaacgcactcggtggtggccaggccatcctcgac
cagctctccccacagatgatctcgctcggcggcgcggcggtccaggaccccaaggtctgg
atcccgttcagcctgatcgcgacggggatgtctaacggcgtcatcgctcacgtgctggtc
aagaacatgtccgcggacagcccgaagacgatcaagcgcaacacctacatctaccccgtg
ctggtcggcgtcctcttcttcatgaccatctcgcttggggtctggggcagtatcgcactc
cccggactggagggcaccgccgtggaccggattctgccggcactggcggagatgtacgcc
ccgacctggatggtcggcctgatcgccgctgggatcttcgccgcgatcatgacctcctgg
gacggcatgctcctggcgacgtcctcgatgttctccgatgacatcatcaagccgatcgcc
aagatgcagggctatgagctctccacgcagtgggagaaccgcttcagcaagttcttcatc
ctggtggtggccctggtcacgtacctgctcgtgctcgcccgtccggacacgatcctggcg
gtcggcgtgttcgcgttcaccggctttgcgacgctggtgccatcctacttcgccgctctc
tactggaaggggacgacgagcacgggtgtggtggcttccgtcgtgatcacgaccccgatc
gtcgcgctctgggccttcgaggtcctcccggcctggacgaccttcggcttccactactcc
gcgccgtcgctgctgctcgcgagtgcactcgtggttgtcgtctcactgctgagtagccca
ccctcgaaggagatcgtcgagcagaacttcgacgtcttcgaccgggtcttccacgactag

DBGET integrated database retrieval system