KEGG   Halodesulfurarchaeum formicicum HTSR1: HTSR_1993Help
Entry
HTSR_1993         CDS       T04517                                 

Definition
(GenBank) Na+-dependent transporter, SNF family
  KO
K03308  neurotransmitter:Na+ symporter, NSS family
Organism
halh  Halodesulfurarchaeum formicicum HTSR1
Brite
KEGG Orthology (KO) [BR:halh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HTSR_1993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNF
Motif
Other DBs
NCBI-ProteinID: AOW81155
UniProt: A0A1D8S732
Position
1901805..1903265
Genome map
AA seq 486 aa AA seqDB search
MTEEATTSREEWGTRFGFMMAMIGAMVGAGNIWRMPYTTGMNGGGAFLLAYIILLYVIAI
PGLMAETMIGRYTGKGVIGTFKQIFDDKTLRGLGFVVVIVNFALMTYYLPLVGEILYYAV
HSVLFTFMDSAFQPEVFWDSFINSPALTVGTHTAVAIGVAAVLSLGIKDGVERMAKYMIP
LMAIALVAVAIRGVTLPGGMEGLSFAFNPDWNYFLRGETWVAALGQALFSTGLGWGVALT
FGSYLRKHDDVPLGGALFTAVGNTSIGLLAIFAVFPVVFAFGLEPTAGTSLAFISLVEVF
PQMPGGGLWAIVFFLGFFFAAFTSAFALTEPIVTTLDEELGFSRSQTVVGVVGLIWLLGV
PSALSQNFLGTMDYMFGNFGLPIATLAVISLVGWKFKPERGRVLDLNRNADIHIGQWWNP
IVRFVIPAVMLFIMAYGAVTSLGTENETLMFGGLALMAIILATSLGLAQALNMQTEDERP
AVSGGD
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagaagcgaccacgtcgcgtgaggagtgggggacccgtttcgggttcatgatg
gcgatgattggggcaatggtcggtgccggcaacatctggcgaatgccctatacgaccggg
atgaacggcggcggcgcgttcctgctcgcctacatcatcctgctgtatgtcatcgccatc
ccgggactgatggccgagacgatgatcggtcggtacacggggaaaggcgtcatcgggacg
ttcaaacagatcttcgacgacaagaccctgcgcgggctcgggttcgtggtggtcatcgtg
aacttcgcgctgatgacctactacctgccgctcgtgggcgagatcctgtactacgcggtc
cactcggtgcttttcaccttcatggattccgcgttccagcccgaggtcttctgggatagc
ttcatcaactcgcccgcgctgaccgtcgggacccacaccgcggtggccatcggcgtggcc
gccgtcctctccctggggatcaaggacggggtcgagcggatggcgaagtacatgatcccg
ctgatggcgatcgcgctggtcgcggtcgccatccgcggcgtgacccttcccggcggcatg
gagggcctttcctttgccttcaaccccgactggaactacttcctgcgcggggagacctgg
gtcgcggcccttgggcaggcgcttttctccaccggcctcggctggggggtcgccctgacc
ttcgggagctacctccgcaagcacgacgacgtgcccctcggcggtgcactgttcacggcc
gtcgggaacaccagcatcggcctgctcgcgatcttcgcagtcttcccggtggtctttgcc
ttcgggcttgagcccaccgcggggacgagtctggccttcatctcgctggtcgaggtcttc
ccgcagatgccgggtggcggcctctgggcgatcgtgttcttcctcggcttcttcttcgcc
gcgttcacgtccgcgttcgcgctgaccgaaccaatcgtgaccacgctcgacgaagaactg
ggcttctcccggagtcagaccgtcgtgggagtcgtcggcctgatctggcttttgggcgtg
ccgagcgcgctctcccagaacttcctgggaacgatggactacatgttcgggaacttcggc
ctgccgatcgccacgctggcggtcatctcgcttgtcggctggaagttcaaacccgagcgg
ggtcgcgtgctcgatctgaaccgcaacgccgacatccacatcggccagtggtggaacccg
atcgtccgctttgtcattccggccgtgatgctgttcatcatggcctacggcgcggtgacg
agtctgggaaccgaaaacgagacgctcatgttcggcggcctcgcgctcatggcgatcatc
ctcgctacgagtctcggactggcccaggcactgaacatgcagacagaggacgaacggccg
gccgtttcgggaggtgactga

DBGET integrated database retrieval system