KEGG   Halorientalis sp. IM1011: BV210_04040Help
Entry
BV210_04040       CDS       T04693                                 

Definition
(GenBank) hypothetical protein
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
hali  Halorientalis sp. IM1011
Pathway
hali00020  Citrate cycle (TCA cycle)
hali00620  Pyruvate metabolism
hali00650  Butanoate metabolism
hali01100  Metabolic pathways
hali01110  Biosynthesis of secondary metabolites
hali01120  Microbial metabolism in diverse environments
hali01130  Biosynthesis of antibiotics
hali01200  Carbon metabolism
Module
hali_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hali_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BV210_04040
   00620 Pyruvate metabolism
    BV210_04040
   00650 Butanoate metabolism
    BV210_04040
Enzymes [BR:hali01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     BV210_04040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF THB
Motif
Other DBs
NCBI-ProteinID: AQL41936
UniProt: A0A1Q1FGK5
Position
797288..798736
Genome map
AA seq 482 aa AA seqDB search
MQEPTQRVADGVTTTDAAAAADLIPDDGIVPTSGLSAGPKDIAHELAASDRDLSLSVPAS
ADAGFVADTELPNADALDLRYPFSAWPNLKRAINDGRVGFVDDHLSVVEQSVAQGYFGDP
DVALVEALAVGEDWLIPTTAVGGVPGFVAAADEVIVEVNEALPLELQQMHDTWTPSTPPR
DPIALSAPDERLGDQFVRFDPDKLAAVVRTENDPIAYPFRDPSDVERTIADNVVEFLADE
LAENPAFRERFAFEVGIGSLGNEIAERIGDLDLSDREAVYFGEVAQDGLLDLLESGTLSA
ASATALVLGENGIDKLLDRPELVADTVLTRSMSVSNDPGLIRAFGVVAINTAVEVDVYGH
TNSSHVRGSQLLQGIGGSGDFARNSLLSMMVLPSTAQDGEISRIVPMASHVDHPDHDVEV
VVTEHGVADLRGLTPDERFEELVGECAHPDFRPDLRRYGERAAEDGGHMPHDLPSAFDMH
TE
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagccgacccagcgcgtcgccgacggtgtcacgacgaccgacgccgccgcggcc
gccgacctgatccccgacgacggcatcgtcccgacgagcggcctcagcgccggcccgaaa
gatatcgcccacgaactcgccgcctcggaccgggacctgtcgctctcggtccccgcgagc
gccgacgcgggcttcgtcgccgacaccgaactccccaacgccgacgcgctcgacctccgc
tatcccttctcggcgtggccgaacctcaagcgcgccatcaatgacggacgggtcggcttc
gtcgacgaccacctctcggtcgtcgagcagtcggtcgcacagggctacttcggcgacccc
gacgtggccctcgtagaagccctcgcagtcggcgaggactggctgatcccgacgaccgca
gtgggcggcgtcccggggttcgtcgctgcggccgacgaggtgatcgtcgaggtcaacgag
gccctgccgctcgaactccagcagatgcacgacacctggacaccgtcgacgccgccccgc
gaccccatcgcgctgtcggcgccggacgagcgcctcggcgaccagttcgtccggttcgac
cccgacaaactggcggccgtcgtccgcaccgagaacgatccgatcgcgtacccgttccgt
gacccctccgacgtggagcggaccatcgcggacaacgtggtcgagtttctggccgacgaa
ctggccgagaacccggcctttcgcgagcgattcgccttcgaggtcggaatcgggtcactg
ggtaacgagatcgccgaacggatcggcgacctcgacctgagcgaccgcgaggcagtctac
ttcggcgaagtcgcacaggacggtctgctcgacctgctggagtcggggacgctctcggcc
gcgagcgcgaccgcgctcgtcctgggcgagaacggcatcgataagttgctcgaccgcccg
gaactcgtggcggacaccgtcctcacgcggtcgatgagcgtctcgaacgaccccggcctg
atccgggcgttcggcgtcgtcgcgatcaacaccgccgtcgaggtcgacgtgtacggccac
accaactcctcgcacgtgcgcgggtcgcaactcctccaggggatcggcggctccggcgac
ttcgcccgcaacagcctgctctcgatgatggtgttaccttcgacggcacaggacggcgag
atctcgcggatagtcccgatggcctcccacgtcgaccaccccgatcacgacgtagaggtg
gtcgtgaccgaacacggcgtcgccgacctgcgggggctgacccccgacgaacggttcgag
gaactcgtcggcgagtgtgcccatcccgatttccgaccggacctccggcgctacggcgaa
cgcgccgccgaggacggcgggcacatgccccacgacctgccgtcggcgttcgatatgcac
accgagtag

DBGET integrated database retrieval system