KEGG   Halorientalis sp. IM1011: BV210_04600Help
Entry
BV210_04600       CDS       T04693                                 

Definition
(GenBank) nicotinamide-nucleotide adenylyltransferase
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
hali  Halorientalis sp. IM1011
Pathway
hali00760  Nicotinate and nicotinamide metabolism
hali01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hali00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BV210_04600
Enzymes [BR:hali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     BV210_04600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID: AQL42038
UniProt: A0A1Q1FGV0
Position
complement(900118..900651)
Genome map
AA seq 177 aa AA seqDB search
MTRGFYIGRFQPFHDGHREMTDRIAEAVDEVVVGIGSADASHTVRNPFTAGERIMMVSRV
LEDIDTRTYVVPIEDIDRNSVWVSHIRSMAPAFDVAYSNNPLVIRLFQEAGIEVRQSEMY
NREDLKGSRIRSRMIDGKDWNHLVPDAVVDVIDEVDGLERLRQVAGDDGGDATENDN
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgacccgggggttctacatcggccgtttccagccgttccacgacggccaccgagagatg
accgaccgcatcgccgaggccgtcgacgaggtcgtcgtcgggatcggcagcgccgacgcc
tcacacaccgtccgcaaccccttcaccgcgggcgaacgcatcatgatggtctcgcgcgtc
ctcgaagacatcgacacccgcacctacgtcgtccccatcgaggacatcgatcgcaactcc
gtctgggtgagccacatccggagcatggcacccgccttcgacgtagcctactcgaacaac
ccgctcgtgatccgcctgttccaggaggccggcatcgaggtccgccagtccgagatgtac
aaccgcgaggacctgaaggggtcgcgcatccgatcgcggatgatcgacgggaaagactgg
aaccacctcgtccccgacgccgtcgtcgacgtgatcgacgaagtcgacgggctagagcga
ctcagacaggtcgccggcgacgacggcggcgacgccaccgagaacgacaactga

DBGET integrated database retrieval system