KEGG   Halorientalis sp. IM1011: BV210_11845Help
Entry
BV210_11845       CDS       T04693                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
hali  Halorientalis sp. IM1011
Pathway
hali00010  Glycolysis / Gluconeogenesis
hali00020  Citrate cycle (TCA cycle)
hali00620  Pyruvate metabolism
hali01100  Metabolic pathways
hali01110  Biosynthesis of secondary metabolites
hali01120  Microbial metabolism in diverse environments
hali01130  Biosynthesis of antibiotics
hali01200  Carbon metabolism
Module
hali_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BV210_11845
   00020 Citrate cycle (TCA cycle)
    BV210_11845
   00620 Pyruvate metabolism
    BV210_11845
Enzymes [BR:hali01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     BV210_11845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP ABC_tran
Motif
Other DBs
NCBI-ProteinID: AQL43339
UniProt: A0A1Q1FKJ8
Position
complement(2316372..2317886)
Genome map
AA seq 504 aa AA seqDB search
MSESGITVREPVTALPDPVESETVVYNPSLDQLREFSREMETTTEFGSPAYVSDHQSRNA
DKTRNAIDHEFDAEDLAYFEDAIEFAASNEMICLDRQVGRHPDHAYVCRYYVPKAYGRIA
LSVAKLFEPVDDPDADPDFVTVQVPEWDETAIRILPEEGFTAVLGSDYTGEAKKSFLRLF
MLRTKEAGGLGLHAGSKRVQLKQDDGDDLKTVGQLFLGLSGTGKSTLTAHGLGLEDPEDA
TMLQDDVCALLSDGSVAGSEGQGLYIKTIGLEREEQPELYDAATDESAVLENVDVAEEGA
VDFDSDHHTTNGRAVIQRSELDSAGEEIDLPALDQIFFITRNPVMPPVAKLDPDEAAAAF
MLGESVQTSAGDPSAAGERIRVVGTNPFIMGSEGEEGNRFRDLIEDLDVDCFVLNTGSVG
GRDVGVDDTVTLLEGISRGTVAWRDDETTGLTVPSEVPGMDVSAFDVAGNLDDADDRVAD
LRAERREYLAQFADLDDDIESAVY
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagtccggaatcacggtgcgagagcccgtcacagccttacccgacccggtcgag
tccgagaccgtcgtctacaacccgtcgctcgaccagctccgggagttctcccgcgagatg
gagacgaccacggagttcggctcgcccgcctacgtcagcgaccaccagtcgcgcaacgcg
gacaagacgcgaaacgcgatcgaccacgaattcgacgccgaggacctcgcgtacttcgag
gacgccatcgagttcgcggcgtcgaacgagatgatctgtctcgaccggcaggttggtcgc
caccccgaccacgcctacgtctgccggtactacgtcccaaaggcgtacggccgcatcgcg
ctgtcggtggccaagctgttcgaaccggtcgacgacccggacgccgaccccgacttcgtc
accgtccaggttcccgaatgggacgagaccgccatccgtatcctccccgaggaaggcttc
acggcggtactgggcagcgattacaccggcgaagccaagaagtccttcctccgcctgttc
atgctccgcacgaaagaggcaggtggtctgggcctccacgccggaagcaagcgcgtccag
ctgaaacaggacgacggggacgacctgaagacggtcggccagttgttcctcggcctctcc
gggaccggcaagtccacgctgaccgcgcacgggctcggtctcgaggaccccgaggacgcg
acgatgttgcaggacgacgtgtgtgcgctcctgtccgacggctcggtcgccggcagcgag
ggtcagggcctgtacatcaagaccatcggcctcgaacgcgaggaacagccggaactctac
gatgccgcgaccgacgagtccgcagtactggagaacgtcgacgtggccgaggagggggcg
gtcgacttcgacagtgaccaccacaccacgaacggccgcgccgtgatccagcgctcggaa
ctcgactccgcgggcgaggagatcgacctcccggcgctggaccagatcttcttcatcacg
cgtaaccccgtgatgccgccggtcgccaaactggatccggacgaggccgccgcggcgttc
atgctcggcgagtccgtccagaccagtgccggcgacccctccgcggccggcgagcggatc
cgcgtcgtcggaaccaaccccttcatcatgggctcggaaggcgaggagggcaaccggttc
cgcgacctcatcgaggatctggacgtggactgtttcgtcctgaacaccggctccgtcggc
ggtcgcgacgtgggcgtcgacgacacggtgacgctgctggagggcatctcccgcggcacc
gtcgcgtggcgcgacgacgagacgaccggcctgaccgtcccgagtgaggtccccgggatg
gacgtctcggcgttcgacgtggccgggaatctggacgacgccgacgatcgggtcgcggac
ctgcgcgcggaacgccgggagtatctggcgcagttcgcggacctggacgacgatatcgag
tcggctgtgtactga

DBGET integrated database retrieval system