KEGG   Halorientalis sp. IM1011: BV210_16050Help
Entry
BV210_16050       CDS       T04693                                 

Definition
(GenBank) 2-phospho-L-lactate transferase
  KO
K11212  LPPG:FO 2-phospho-L-lactate transferase [EC:2.7.8.28]
Organism
hali  Halorientalis sp. IM1011
Pathway
hali00680  Methane metabolism
hali01100  Metabolic pathways
hali01120  Microbial metabolism in diverse environments
Module
hali_M00378  F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:hali00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BV210_16050
Enzymes [BR:hali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.28  2-phospho-L-lactate transferase
     BV210_16050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0052
Motif
Other DBs
NCBI-ProteinID: AQL44126
UniProt: A0A1Q1FMS7
Position
3100983..3101975
Genome map
AA seq 330 aa AA seqDB search
MVTFLSGGTGTPKLLRGADDIFPPAETTVVCNTGDDVELGGHLVCPDVDTVLFLGGDELD
LDTWWGIADDATVTDDELHRLADAAGLDGGPRYLPDEQQTSGREIARWRRFSGVAEFMLI
GDRDRAVHLTRTGLLDEGHTLTEVTRTLADAFDTPWEVLPMSDDPVASIVHTPDGPMHFQ
EFWVGRDGDPTVESVELRGGTEATATDAVLTALDDPVVVGPSNPITSIGPMISVEGIESA
LRETPVVAVSPFVEDRVFSGPAAKLMAAEGFDPSTAGVAEAYDFADAFVLDSEDGTDLDR
PVVRTDTRLDTEADARRVAEACKDALEVVA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggtcacgtttctctccggggggacgggcacgccgaaactcctccggggcgcggacgat
atctttccgccggccgagacgaccgtcgtctgcaacaccggcgacgacgtggaactcggc
gggcacctcgtctgtccggacgtcgacaccgtcctctttctcggcggcgacgaactcgat
ctcgatacgtggtggggcatcgccgacgacgctaccgtcaccgacgacgaactccaccgc
ctcgccgacgccgccggtctcgacggtggcccgcggtacctccccgacgagcagcagact
tcgggtcgggagatcgcacgctggcggcgcttctccggcgtcgcggagttcatgctgatc
ggcgaccgcgaccgcgcggtccacctcacccgcaccggcctcctcgacgagggccacacg
ctcaccgaggtcacccggacactcgccgatgccttcgatacgccgtgggaggtgctgccg
atgagcgacgaccccgtcgcgagcatcgtccacacacccgacgggccgatgcacttccag
gagttctgggtcggccgcgacggcgacccgaccgtcgagtccgtcgagctccggggcggc
accgaggcgaccgcgaccgacgctgtgctgacggccctcgacgaccccgtcgtcgtcggc
ccctcgaatccgatcaccagcatcggtccgatgatttccgtcgaaggaatcgagagtgcg
ctccgggagacgccggtcgtggcagtctccccgttcgtcgaggatcgggtgttctccggc
ccggcggcgaaactgatggccgccgaggggttcgatccctcgaccgctggcgtcgccgag
gcctacgacttcgcggacgcgttcgtcctcgacagtgaggacggcaccgacctcgaccgg
ccggtcgtccggaccgacacgcgactcgacaccgaggccgacgcccgtcgagtggccgaa
gcttgtaaggacgcgctggaggtggtcgcgtga

DBGET integrated database retrieval system