KEGG   Halomonas alkaliphila: CUU95_01940Help
Entry
CUU95_01940       CDS       T05720                                 

Definition
(GenBank) rRNA (guanine-N1)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
halk  Halomonas alkaliphila
Brite
KEGG Orthology (KO) [BR:halk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:halk03009]
    CUU95_01940
Enzymes [BR:halk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CUU95_01940
Ribosome biogenesis [BR:halk03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CUU95_01940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Ubie_methyltran Methyltransf_23 Methyltransf_12 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AYF32660
UniProt: A0A386WYZ3
Position
complement(410123..410986)
Genome map
AA seq 287 aa AA seqDB search
MNSTPFQLLACPLDGEPLNLAGSTWRCSAGHSFDVAKQGYVNLLPVQQKRSADPGDSKLM
VAARQRFLEAGYYQPIAQAVSKHLISHAEAQPASSLFSCLDAGCGEGYYLRELSRAVSNS
RPLSLLGLDISKWAVLSAARQDDKKSPLCRWVVGSNAHLPVQAKTLDSVLCMFGFPVHHE
FARVLKPGGLLVQVEAGVGHLRELREVIYPTLKPDTTSEREVPEGFTQLHTESLNYQITL
EGQALIGDLLTMTPHLYRASQEGRARAATLDELTLTVDAKLMVYERK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcactccttttcaattactagcctgtccgttagatggcgagccgcttaatctt
gcaggcagtacttggcgctgctctgctgggcatagcttcgatgttgctaagcaaggttac
gtcaacttgcttccggtacagcaaaagcgttccgctgaccctggtgacagtaaactgatg
gtggcggcgcggcagcgttttcttgaggctggttactatcagcccattgcccaggcggta
agcaaacatctgataagccatgctgaggctcaacctgctagttcgctatttagctgcctg
gatgctggctgcggtgaaggctattacttgcgtgagctatctcgtgctgtatcgaattcg
cggccactttcactgctgggattagatatttccaagtgggcagtgctgtcggcggccagg
caagatgataaaaaatctccgctttgtcgttgggtcgtcgggagcaatgcgcacttgcca
gttcaagcgaagacgctcgacagcgtgctgtgtatgtttggctttccagtgcatcacgaa
tttgcgcgggtattaaagccgggtggcctgttggtgcaggttgaggcaggagtggggcac
ttgcgtgagctgagggaggtgatttatcccacgcttaagccagacacgacaagtgaacgg
gaagtgcctgagggctttacccagttgcacaccgagtcacttaactatcaaataacgctg
gaagggcaggcattaattggtgatctattaacgatgacgccccatctttaccgtgccagt
caggaggggcgggcacgtgcagcgacacttgatgagcttaccctgacggtggatgccaaa
ctaatggtgtatgagcgtaaatag

DBGET integrated database retrieval system