KEGG   Halomonas alkaliphila: CUU95_09060Help
Entry
CUU95_09060       CDS       T05720                                 

Definition
(GenBank) 23S rRNA pseudouridine(1911/1915/1917) synthase RluD
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
halk  Halomonas alkaliphila
Brite
KEGG Orthology (KO) [BR:halk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:halk03009]
    CUU95_09060
Enzymes [BR:halk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     CUU95_09060
Ribosome biogenesis [BR:halk03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CUU95_09060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AYF33965
UniProt: A0A386WZT1
Position
1962989..1963948
Genome map
AA seq 319 aa AA seqDB search
MSRIVEATQRVPATLAGARLDQAAAELFSDYSRERLKAWINAGELTVDGAKVKPKAKLHG
HETLALKATIEDDTRFEPQDIPLDIVYEDDAVIVINKAAGMVVHPAAGNPDGTLLNALLH
HHPALAEVPRAGIVHRLDKDTTGLMMVAKTLPAQTTLVEQLQARSVSRQYDAVVIGKPVS
GSTIDAPIGRHPKDRKRQAVTASGKPAVTHFRVVERFRAHTHVRCQLETGRTHQIRVHMA
HARYPLIGDPLYSGRAKLPPGAAAPLKEILREFPRQALHARKLSFVHPVSGETLTFHADL
PDDLLMLLDYLREDSETMR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtattgttgaagccacgcagcgagtacccgcgacattagctggcgcgcgttta
gaccaagccgcagctgagttgttcagcgattattcccgcgagcgtttgaaagcgtggatc
aacgccggtgagctcaccgtcgacggcgctaaagtaaaaccgaaggccaagctgcacggc
cacgaaacattagcgcttaaagcgactattgaagacgatactcgttttgagccccaagat
attccgcttgatatcgtttatgaagacgacgcggtaatagtcatcaacaaagccgcgggc
atggtggttcatcccgccgcgggcaaccctgatggcacattgttgaatgcgttgctccat
catcatcctgcactggcagaagtgcctcgggcgggaatcgtacatcgcctggataaagac
accactggtctaatgatggtggcgaaaacgttgcccgcacaaacgacgctggttgagcag
ttgcaggcgcgcagcgtttctcgtcaatatgatgcagtggtgattggcaagcccgtgtcg
ggcagcaccattgacgcgcccattggtcggcacccaaaagaccgcaagcgccaagcggtc
acggcttctgggaaaccggcagtgactcactttcgggtggttgagcgtttccgcgcgcat
acccatgtgcgttgccagttggaaaccgggcgtacccatcaaattcgcgttcatatggct
catgcccgctacccattgattggcgatccgctctatagtggccgtgctaagctgccgccg
ggtgctgctgcgccgttaaaagagattttgcgtgaatttccgcgtcaggcgctgcatgct
cggaagctcagttttgtgcatccggtgagtggtgaaacgcttacttttcatgccgacttg
cctgatgatctactgatgttgttggattacctgcgcgaagatagtgagaccatgagatga

DBGET integrated database retrieval system