KEGG   Haloprofundus sp. MHR1: FCF25_03640Help
Entry
FCF25_03640       CDS       T05952                                 

Definition
(GenBank) bifunctional precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
halm  Haloprofundus sp. MHR1
Pathway
halm00860  Porphyrin and chlorophyll metabolism
halm01100  Metabolic pathways
halm01110  Biosynthesis of secondary metabolites
halm01120  Microbial metabolism in diverse environments
Module
halm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:halm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FCF25_03640
Enzymes [BR:halm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     FCF25_03640
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     FCF25_03640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M CysG_dimeriser
Motif
Other DBs
NCBI-ProteinID: QCJ48480
UniProt: A0A4D7HBE4
Position
736088..736759
Genome map
AA seq 223 aa AA seqDB search
MIPLFHDFADETVLVFGGGAVGARKARRFADEARVVVVSPEFGGGGGDGDADTDEFGGAE
LVRAAPAPDEIVDWVDRFDPALVVAATNDETVNEAVETAAKDAGALVNRTDRAGSRDARS
VVVPATVDDDPVTVAISTGGRSPALSKHLRERIEAELDGAGAMAELTGEIRAELKAEGVD
PTERREAVRAVVGSSPVWKALRTGESNARREAQRVIRNRGESP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgattccgctgtttcacgacttcgcggacgagacggtgctcgtcttcggcggcggcgca
gtcggtgcgcggaaggcgcgacgcttcgccgacgaagcccgcgtcgtcgtcgtcagcccc
gagttcggaggcggcggcggcgacggcgatgccgacaccgacgagttcggcggcgcggaa
ctggtccgcgccgctcccgcccccgacgagatcgtcgactgggtcgaccggttcgacccg
gcgctcgtcgtcgcggcgacgaacgacgagacggtgaacgaggcggtcgagacggcggcg
aaggacgccggggcgctggtcaaccggaccgaccgcgcgggaagccgcgacgcccgcagc
gtcgtcgtccccgcgaccgtcgacgacgaccccgtcaccgtcgccatctcgacgggcgga
cggagtccggcgctctcgaaacacctccgcgagcgaatcgaggcggaactcgacggtgcg
ggtgcgatggccgaactgaccggagagattcgcgcggaactgaaagccgagggcgtcgac
ccgaccgagcgacgcgaggcggttcgagcggtcgtcggctcgtctcccgtttggaaggct
ttacgtacgggcgaatccaacgcccggagagaggcccagcgcgtgatacggaacagaggt
gagtccccgtga

DBGET integrated database retrieval system