KEGG   Haloprofundus sp. MHR1: FCF25_07795Help
Entry
FCF25_07795       CDS       T05952                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
halm  Haloprofundus sp. MHR1
Pathway
halm00260  Glycine, serine and threonine metabolism
halm01100  Metabolic pathways
halm01110  Biosynthesis of secondary metabolites
halm01120  Microbial metabolism in diverse environments
halm01130  Biosynthesis of antibiotics
halm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:halm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FCF25_07795
Enzymes [BR:halm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     FCF25_07795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_3 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: QCJ47020
UniProt: A0A4D7H7J1
Position
complement(1553887..1554912)
Genome map
AA seq 341 aa AA seqDB search
MIDLRSDTVTMPSDEMREAARDADVGDDVYRDDPTVNELERRAADLVGKEAALYVPSGTM
GNQIAVRVHTDRGQEILCDEEAHVVKWELGGIAQLSQLQVRTIDCGDRCVPTPEQVRERY
VEEDLHRPGTGLLSLENTHNSRGGVAVPKEHVDAAARAAHDLGVPVHLDGARVFNAAVAL
DEDPESLVENVDSVMFCLSKGLGAPVGSILAGDEEFVDRARRTRKLLGGGMRQAGIIAAP
GLLALDNVDRLAEDHENARTLAAGLDAIDGLRAPTPDSNIVVVDVAGAGLTADEFVDACV
DEGVACGAFGETTVRLCTNWDVSAADVEEALDRIPVAVESA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatagacctccggagcgacaccgtcacgatgccgagcgacgagatgcgcgaggccgcc
cgcgacgccgacgtcggcgacgacgtctaccgcgacgacccgaccgtcaacgaactcgaa
cgccgcgcggccgacctcgtcggcaaagaggccgcgctgtacgtcccctcggggacgatg
ggcaaccagatcgctgtccgcgtccacaccgaccgcggtcaagagatcctctgcgacgaa
gaggcccacgtcgtcaagtgggaactcggcggcatcgcccagctctcgcagctccaagtt
cgaaccatcgactgcggcgaccggtgcgtcccgacgcccgaacaggtccgagagcgctac
gtcgaggaggacctccaccgacccggcacgggtctcctgtcgctcgaaaacacgcacaac
agtcgcggcggcgtcgccgtccccaaagaacacgtcgacgccgcggcgagggcggctcac
gacctcggcgtcccggtccacctcgacggcgcgcgcgtgttcaacgccgccgtcgccctc
gacgaagaccccgaatccctggtcgagaacgtcgacagcgtgatgttctgtctctcgaag
gggctcggcgcgcccgtcggctcgattctcgccggcgacgaggagttcgtcgaccgcgct
cgacggaccagaaaactgctcggcggcgggatgcgtcaggcgggtatcatcgccgcgccc
ggcctcctcgcgctcgacaacgtcgaccgactcgccgaggaccacgagaacgcccggacg
ctcgcggccggactggacgccatcgacggcctccgcgcgccgacgcccgactcgaacatc
gtcgtcgtcgacgtcgccggcgcggggctgaccgccgacgagttcgtcgacgcgtgcgtc
gacgagggcgtcgcctgcggggcgttcggcgagacgaccgtccgactctgtacgaactgg
gacgtctccgcggccgacgtcgaggaggcgctcgaccgcattcccgtggccgtcgagtcg
gcgtag

DBGET integrated database retrieval system