KEGG   Haloprofundus sp. MHR1: FCF25_11780Help
Entry
FCF25_11780       CDS       T05952                                 

Definition
(GenBank) glucose dehydrogenase
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
halm  Haloprofundus sp. MHR1
Pathway
halm00030  Pentose phosphate pathway
halm01100  Metabolic pathways
halm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:halm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FCF25_11780
Enzymes [BR:halm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     FCF25_11780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N ADH_N_2
Motif
Other DBs
NCBI-ProteinID: QCJ47757
UniProt: A0A4D7H3B1
Position
2330112..2331197
Genome map
AA seq 361 aa AA seqDB search
MKAIAVYEGAEKPGVVDVPKPEPSTGEALVRTLRVGVDGTDHEVLSGGHGGFPEGEEFLV
LGHEAVGVVEDPNGTDLERGEVVVPTVRRPPNGPNDYFERGEPDMAPAGEYHERGIDGAH
GFMAEYFTSPEEYLVPIPEELASVGFLVEPVSISEKAIEHAYASRSAFEWSPESALVLGN
GSLGLLTLAMLGFEYGYDADRLYCLGRRDRPDPTIDVIEELGATYVDSRETPVDEIPEVH
EPMDFVYEATGFPKHVFQSVHALAPNGVAALLGVPSDWEFEVDGGAFHSELVLHNKALVG
SVNSHVGHFEAATESLASMPAWLLDSLVTGIYGLDEFERAFDDDDTTIKTAVQFSTYEER
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatagcggtgtacgagggggccgagaaaccgggcgtcgtcgacgttccgaaa
ccggagccgtcgacgggcgaggcgctcgtccgaacgcttcgcgtgggcgtcgacggcacc
gaccacgaggtgctgagcgggggtcacggcgggttccccgagggcgaggagttcctcgtg
ctcggccacgaggccgtcggcgtcgtcgaggaccccaacggcaccgacctcgaacgcggc
gaggtcgtcgtgccgacggttcgccgcccgccgaacggacccaacgactacttcgaacgg
ggcgaacccgatatggctcccgcgggcgagtaccacgagcgcggcatcgacggcgcgcac
ggcttcatggcggagtacttcacgagccccgaggagtatctcgtgcccatccccgaggag
ctcgcgtcggtcggcttcctcgtcgaaccggtctccatctccgagaaagccatcgaacac
gcctacgcgtcgcgttccgcgttcgagtggagccccgaatcggcgctcgtgctcggcaac
ggcagcctcggcctgctgacgctggcgatgctcggcttcgagtacggctacgacgccgac
cgcctctactgtctgggccgccgcgaccgccccgacccgactatcgacgttatcgaggag
ctcggcgcgacgtacgtcgactcccgggagacgccggtcgacgagattcccgaggtacac
gaaccgatggacttcgtctacgaggcgaccggattcccgaaacacgtcttccagtcggtc
cacgcactcgcgccgaacggcgtggcggcgcttctgggcgtgcccagcgactgggagttc
gaggtcgacggcggcgcgttccacagcgagctcgtcctccacaacaaggcgctcgtcggc
agcgtcaactcccacgtcggacacttcgaggcggcgacggagtcgttggcgtcgatgccg
gcgtggctcttggactcgctcgtcaccggaatctacggcctcgacgagttcgaacgagcg
ttcgacgacgacgacaccactataaaaaccgccgtgcaattcagtacgtatgaagaacgt
cgatga

DBGET integrated database retrieval system