KEGG   Halomonas sp. 1513: BWR19_00260Help
Entry
BWR19_00260       CDS       T04761                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
halo  Halomonas sp. 1513
Pathway
halo00040  Pentose and glucuronate interconversions
halo00053  Ascorbate and aldarate metabolism
halo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:halo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BWR19_00260
   00053 Ascorbate and aldarate metabolism
    BWR19_00260
Enzymes [BR:halo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     BWR19_00260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh IlvC
Motif
Other DBs
NCBI-ProteinID: APX91510
UniProt: A0A1P8QYL4
Position
57028..58605
Genome map
AA seq 525 aa AA seqDB search
MSLSGQLIIGQQAVSGDRAEIRATNPATGEALEPVYRGGGQVEVAQACELAEAAFDAYRE
TTLEERATFLETIASEIEAIGDELTQRGMAETGLPQARLEGERGRTCGQLRLFASVVRAG
EWLDVRHDPALPERAPMPRVDLRQRHIALGPVAVFGASNFPLAFSVAGGDTASALAAGCP
VVVKGHSAHPGTSELVGRAIQRAVAKCRLPEGTFSLLFGSGREIGQALVSDPRIQAVGFT
GSRSGGTALMQTAQARPQPIPVYAEMSSINPVFLLPEALAARGVEIADGFVGSLNMGAGQ
FCTNPGLVLGVKGEALDAFIRAAGAAVTASAAQTMLTPGIHGAYADGLGALAGNAKVREI
ARGASGDGPHQCQTGLFVASAADFLADEALQAEVFGATSLVIECADQAEMQRVAKGLEGQ
LTVTLQMDDGDLAAAKALLPILERKAGRILANGWPTGVEVCHAMVHGGPYPATSDARTTS
VGSAAIQRFLRPVCYQALPEGLLPEALKDGNPLGVSRLVDGKREA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagcttatctggacaactcatcatcggccagcaggccgtcagcggcgatcgcgccgag
atccgcgccaccaatcccgccaccggcgaggccctcgagccggtctatcgcggtggcggc
caggtcgaggtcgcgcaggcctgcgaactcgccgaggcggccttcgacgcctaccgcgag
accacgctcgaggaacgcgcgacctttctcgagaccattgccagcgagatcgaggcgatc
ggcgatgagctgacccagcgcggcatggccgagaccggcctgccccaggcacgcctcgag
ggcgagcgcggccgcacctgcggtcagctgcgcctgttcgcctcggtggtgcgcgccggc
gagtggctcgacgtacgtcacgacccggcgctgcccgagcgcgcgccgatgccccgcgtc
gacctgcgccagcggcatatcgccctgggcccggtcgccgtgttcggtgcctccaacttc
ccgctggcgttctcggtggccggcggcgacaccgcctcggcactggccgccggctgcccg
gtggtggtcaagggccactccgcccaccccggcacctcggagctggtgggccgtgccatc
cagcgcgctgtcgccaagtgccgcctgcccgagggcaccttctcgctgctgttcggctcg
gggcgtgagatcggccaggcgctggtcagcgacccacgcatccaggcagtgggctttacc
ggctcgcgcagcggcggtaccgccttgatgcagaccgcccaggctcggccacagccgatc
ccggtctacgccgagatgagctcgatcaatccggtgttcctgctgccggaagcgctcgcg
gcgcgcggtgtcgagatcgctgacggcttcgtgggttccttgaacatgggcgccggccag
ttctgcaccaaccccggcctggtgctgggcgtcaagggcgaggcgctggacgcctttatc
cgtgccgccggcgcagcggtcacggcaagcgccgcccagaccatgctcacccccggcatt
cacggcgcctatgccgacggcctgggcgcgcttgccggtaacgccaaggtgcgtgaaatc
gcccgcggcgcatcgggtgatggcccgcatcagtgccagaccgggctgttcgtggctagc
gccgcggacttcctcgccgacgaggcgctacaggccgaggtcttcggtgccacctcgctg
gtgatcgagtgcgccgaccaggccgagatgcagcgcgtggccaagggcctggaggggcag
ctgaccgtcaccctacagatggacgatggcgacctggccgccgccaaggcgctgctgccg
atcctcgaacgcaaggccgggcggatcctcgccaacggctggcccaccggggtcgaggta
tgccacgccatggtccacggcggcccttatccggcgacgtcggatgcccgcaccacctcg
gtgggcagcgccgcgatccagcgcttcctgcgcccggtgtgctaccaggcgctgccggaa
gggctactgcccgaggcgctcaaggacggcaacccactgggcgtgtcacggctggtggac
ggcaagcgcgaagcgtga

DBGET integrated database retrieval system