KEGG   Halomonas sp. 1513: BWR19_09620Help
Entry
BWR19_09620       CDS       T04761                                 

Definition
(GenBank) NADH pyrophosphatase
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
halo  Halomonas sp. 1513
Pathway
halo00760  Nicotinate and nicotinamide metabolism
halo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:halo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BWR19_09620
Enzymes [BR:halo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     BWR19_09620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX zf-NADH-PPase DZR DNA_RNApol_7kD Ribosomal_L37e Zn_Tnp_IS1595
Motif
Other DBs
NCBI-ProteinID: APX93166
UniProt: A0A1P8R3G1
Position
complement(2139849..2140631)
Genome map
AA seq 260 aa AA seqDB search
MLRRELPRDAHFGHLLWVAEGRVAEGEHGTPLFAPQAWQPDDLPLGYWHDVPVALRLGEA
IDPRYDWHAGREWLSRLPERWFALLSTALQVANWWRDHRYCGRCGSRSRHLTHEFAMHCD
SCGHRNYPRISPCIITLVTHGDAMLLARSPRYPPGRYSTLAGFIEPGESAEEAVRREVDE
EVGVSVGRISYYRSQAWPFPHALMLGYFAEAASRRIRIDDREIADAAWFSPRQLPQLPPH
YSISRALIESHLRAVARGDG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtcgtgagctgcctcgcgatgcccacttcggccacctgctatgggtggcggaa
gggcgggtcgcggagggcgagcacggcacgccgctgtttgcccctcaagcgtggcagccc
gacgacctgccgctggggtactggcacgatgtgccggtggcgctgcgtctcggcgaagcg
atcgacccacgctacgactggcacgccgggcgcgagtggctgtcgcgcttgcccgagcgc
tggttcgcactgctgtcgacggcgctgcaggtggccaactggtggcgcgaccaccgttac
tgcggtcgctgcgggagccgttcacgccacctgacccacgagtttgccatgcactgtgat
agctgtggtcaccgcaactatccgcgcatttcaccgtgcatcatcaccctggtgacccat
ggcgatgccatgctgctggcgcgcagcccgcgctatccgccggggcgttactcgacgctg
gcgggattcatcgagccgggagagtccgcggaggaggccgtgcgccgtgaggtcgacgag
gaggtcggcgtcagcgtcgggcgcatcagctactaccgcagccaggcctggccgttcccc
cacgcgctgatgctcggctatttcgccgaggccgccagccgacggatccgcatcgacgat
cgtgaaatcgccgacgcggcttggttttcgccgcgccagctgcctcaactgccgccgcac
tactcgatctcgcgggcgctgatcgagtcgcacctgcgggcggtcgcccggggcgacggc
tga

DBGET integrated database retrieval system