KEGG   Halomonas sp. 1513: BWR19_13325Help
Entry
BWR19_13325       CDS       T04761                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
halo  Halomonas sp. 1513
Pathway
halo00071  Fatty acid degradation
halo00072  Synthesis and degradation of ketone bodies
halo00280  Valine, leucine and isoleucine degradation
halo00310  Lysine degradation
halo00362  Benzoate degradation
halo00380  Tryptophan metabolism
halo00620  Pyruvate metabolism
halo00630  Glyoxylate and dicarboxylate metabolism
halo00640  Propanoate metabolism
halo00650  Butanoate metabolism
halo00900  Terpenoid backbone biosynthesis
halo01100  Metabolic pathways
halo01110  Biosynthesis of secondary metabolites
halo01120  Microbial metabolism in diverse environments
halo01130  Biosynthesis of antibiotics
halo01200  Carbon metabolism
halo01212  Fatty acid metabolism
halo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:halo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BWR19_13325
   00630 Glyoxylate and dicarboxylate metabolism
    BWR19_13325
   00640 Propanoate metabolism
    BWR19_13325
   00650 Butanoate metabolism
    BWR19_13325
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BWR19_13325
   00072 Synthesis and degradation of ketone bodies
    BWR19_13325
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BWR19_13325
   00310 Lysine degradation
    BWR19_13325
   00380 Tryptophan metabolism
    BWR19_13325
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BWR19_13325
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BWR19_13325
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BWR19_13325
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:halo04147]
    BWR19_13325
Enzymes [BR:halo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BWR19_13325
Exosome [BR:halo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BWR19_13325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APX93838
UniProt: A0A1P8R5B4
Position
2922813..2924000
Genome map
AA seq 395 aa AA seqDB search
MAASNDIVILSAARTPMGGMLGSLSSLTAPELAAVAIRAAIERAGIEPDEIDEGFLGCVL
PGGVKQGPARQAMRQAGIPDQIGATTINKLCGSGMKAVMLAHDLIRAGSGELILAGGMES
MSNAPHLLTKARSGYRLGHGELKDHMFHDGLEDAETGQLMGTFAQQVADQRGYGRERMDD
FAIASLERAMAAHEAGHLAAEMAPVTVTSRSGETLVAHDEQPFQAKLDKIRSMRPAFAKD
GTITAANASSISDGASAVIVASRAAAQAHGLTPIARVLGHSTFSRHPSEFTIAPVGAIAA
LLERLDWTVEDVDLFEVNEAFAVVTLMAMDDLEIPHAKVNIFGGACAQGHPVGSTGSRII
ATLINALRVTGGKRGVASLCIGGGEATAIAVELAD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcagcatccaacgatatcgtgattctttccgccgcccgcaccccgatgggcggcatg
ctgggcagcctgtcgagcctcaccgctcccgaactcgccgcggtggcgatccgtgccgcg
atcgagcgtgccggcatcgaacccgacgagatcgacgagggctttctcggctgcgtgctg
cccggcggggtcaagcagggcccggcgcgccaggcgatgcgccaggccgggattcccgac
cagatcggcgccaccactatcaacaagctgtgtggctcgggcatgaaggccgtgatgctg
gcccacgacctgatccgcgccggcagcggcgagctgatcctggccggcggcatggagtcg
atgtccaacgccccgcatctgctgaccaaggcacgcagcggctatcgcctcggccacggc
gagctcaaggaccatatgttccacgacggcctcgaggacgccgagaccggccagctgatg
ggcaccttcgcccagcaggtcgcagaccagcgcggctacggccgcgagcgcatggacgac
ttcgccatcgcctcgctggagcgcgccatggccgcccatgaggccggccacctggctgcc
gaaatggccccggtgacggtcacctcgcgcagcggcgagacgctggtggcgcacgacgag
cagccgttccaggccaagctcgacaagatccgcagcatgcgcccggcgtttgccaaggac
ggcaccatcaccgccgccaacgccagctcgatctccgacggcgcctcggcggtgatcgtc
gccagccgcgccgcggcccaggcccacggcctgacgccgattgcccgggtgctcggccac
agcaccttctcgcgccaccccagcgagttcaccatcgccccggtgggcgccatcgccgcg
ctgctcgagcgcctcgactggacggtggaggacgtcgacctgttcgaggtcaacgaggcc
ttcgccgtggtcactctgatggccatggacgacctcgagatcccccacgccaaggtcaac
atcttcggcggcgcctgcgcccagggccacccggtgggctctaccggctcgcggatcatc
gccaccctgatcaacgccctgcgcgtcaccggcggcaagcgcggcgttgccagcctgtgc
atcggcggcggcgaggctaccgccatcgccgtggagctggccgactaa

DBGET integrated database retrieval system