KEGG   Halomonas sp. 1513: BWR19_14110Help
Entry
BWR19_14110       CDS       T04761                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
halo  Halomonas sp. 1513
Pathway
halo00970  Aminoacyl-tRNA biosynthesis
halo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:halo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BWR19_14110
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:halo03029]
    BWR19_14110
Enzymes [BR:halo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BWR19_14110
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BWR19_14110
Mitochondrial biogenesis [BR:halo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BWR19_14110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: APX95038
UniProt: A0A1P8R8Q0
Position
3107997..3109442
Genome map
AA seq 481 aa AA seqDB search
MRRHPHKERRVNDTDLGVLDAAHLVERYRRRDCSPLEATRAALERIERFNPAVNAYVYVD
HEGAEKAARASARRWGKGEPLSAIDGVPVSLKDLTAVAGMPSRDGSLTTDDVPREHDSPP
ARKLREAGAILLGKTNTPEFGWKGVTDSLVHGATRNPWDTRLTPGGSSGGAGVAAALNMG
VLHQGGDSGGSIRIPAAFTGTFGFKPSFGWVPQWPPSQEPTLSHLGPITRTVGDAALMLN
VIGRYDYHDPYAIRGQPDDWGSDIGQGIEGLRIAYSADLGYAKVDPQVAQRVREAADKLA
ALGAEIVEVDPGFASPLSTFQTIWFTASLDMYQQLSASQREQLDPGLVSNALRAESLSSV
DLFRALSERARLTERLEHFNRDYHLLMTPAVAVEPFAINHEVPPGSGMQDWEDWAPFSYP
FNLSQQPAASVPCGFTDKGLPVGFQLAGGKFDDQRVLRVCHAFMEAYPPRFPAMPDPIQQ
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgccacccacacaaggagagacgtgtgaacgacacagacctcggcgttctcgac
gccgcccatctcgtcgagcgctatcgacgccgcgactgctcgccgctggaggccacccgc
gccgccctcgaacggatcgaacgcttcaatcctgccgtcaacgcctatgtatacgtcgat
cacgagggtgccgagaaagccgcccgagcctcggcgcggcgctggggcaagggcgagccg
ctgagcgccatcgacggcgtgccggtgtcgctcaaggacctcaccgcggtggccggcatg
ccctcccgggacggctcgctgaccaccgatgacgtcccccgtgagcacgactcgccgccg
gcccgaaagctgcgcgaggccggggcgatcctgctcggcaagaccaatacgccggagttc
ggctggaagggcgtgaccgacagtctcgtccacggcgccacccgcaacccctgggatacc
cggctgaccccgggcggctcctccggcggcgcgggcgtcgccgcggcgctgaacatgggc
gtgctgcaccagggcggcgactctggcggttcgattcgcattcccgccgctttcaccggc
actttcggcttcaagccgtcgttcggctgggtgccccagtggccgccctcccaggagccg
acactctcgcacctcggtccaatcacccgcaccgtgggcgatgcggccctgatgctcaac
gtgatcggccgctatgactaccacgacccctacgccatccgcggccagcccgacgactgg
ggcagcgatatcggccagggcatcgaagggctgcgcatcgcctactccgccgacctcggc
tatgccaaggtcgacccccaggtcgcccagcgcgtcagggaggccgccgacaagctcgcg
gcactcggcgccgagatcgttgaggtcgaccccggtttcgcctcaccgctctccaccttc
cagaccatctggttcaccgcctcgctggacatgtaccagcagctgagcgccagtcagcgc
gaacagctcgaccccggtctggtctcgaatgcgctgcgcgccgagtcgctgtcgtcggtg
gatctgttccgcgccctcagcgagcgcgcacggctgaccgagcggttggaacacttcaat
cgcgactatcatctgctgatgaccccggcagtggccgtcgagccgtttgccatcaaccac
gaggtaccgccgggcagcggcatgcaggactgggaggactgggcgcccttctcttacccc
ttcaacctcagccagcagcccgccgcctcggtgccctgcggctttaccgacaaggggctg
ccggtgggcttccaactggccggcggcaagttcgacgaccagcgtgtgctgcgcgtctgc
catgccttcatggaggcatatccgccacgcttcccggccatgcccgaccccattcaacag
gcctga

DBGET integrated database retrieval system