KEGG   Halomonas sp. 1513: BWR19_14810Help
Entry
BWR19_14810       CDS       T04761                                 

Definition
(GenBank) fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
halo  Halomonas sp. 1513
Pathway
halo00051  Fructose and mannose metabolism
halo01100  Metabolic pathways
halo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:halo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BWR19_14810
Enzymes [BR:halo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     BWR19_14810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-ProteinID: APX94103
UniProt: A0A1P8R607
Position
3266319..3267617
Genome map
AA seq 432 aa AA seqDB search
MTSITHLTVQDVRFPTSRSLDGSDAMNAAPDYSATYVILHTDSDLEGHGLTFTIGRGNEL
CVKAVESLAYLVEGETLETITADMGTFWRRLTSGDSQLRWTGPEKGVIHLATAAIVNALW
DLWAKSEGKPVWKLLVDMTPEQLVKSLDFRFVSDAITPEEALGLLRRQAAGRQQREEEMH
ARGYPGYTTSAGWLGYDDDKVRRLAREALAEGWTHFKQKVGGNLEEDRRRAQILREEIGW
ERALMMDANQMWDVDEAITNMRQLAEFDPLWIEEPTSPDDILGHAEIRQRLGSIGVATGE
HCHNRVMFKQLLQAEAIDYCQLDAARLGGLNEVIVVLLMAAKFGVPVCPHAGGVGLCEYV
QHVSIFDYIAVSGSLEGRILEYVDHLHEHFEHPVVIRNGHYQVPTAPGYSITLKPASLAE
HVYPDGPAWQTH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgatcacccacctcacggttcaggacgttcgcttccccacttctcgctcgctg
gatggctccgatgccatgaacgccgcccccgactactcggctacctacgtcatcctgcat
accgatagcgacctggaggggcacggcctcaccttcaccatcggccgcggtaacgagctg
tgcgtcaaggccgtagagtcgctggcctatctggtcgagggcgagacactggagacgatc
accgctgatatgggtacgttctggcgccggctcaccagcggtgacagccaactgcgctgg
accggccccgagaagggcgtgatccatctcgccaccgctgccatcgtcaatgcactctgg
gacctgtgggccaagtcggaaggcaagccggtgtggaaactgctggtggacatgaccccg
gaacagctggtcaagagcctcgatttccgcttcgtcagcgatgccatcacccccgaggag
gcgctgggcctgctccgccgtcaggcagccggacgccagcagcgtgaagaggagatgcac
gcgcgcggctaccccggctacaccacctcggcgggctggctcggctacgacgatgacaag
gtacggcgcctggcccgtgaggcgctggccgaaggctggacgcacttcaagcagaaagtc
ggtggcaacctcgaggaggaccgacgtcgcgcccagatactgcgcgaggagatcggctgg
gaacgtgcgctaatgatggacgccaaccagatgtgggacgtcgacgaggccatcaccaac
atgcgccagctggccgaattcgatccgctgtggatcgaggagccgaccagccccgacgat
atcctcggtcacgccgagattcgccagcggctgggctcgatcggcgtggccaccggcgag
cactgccacaaccgggtgatgttcaaacagctgctccaggccgaagccatcgactactgc
cagctcgatgccgcgcggctaggcgggctcaacgaggtcatcgtggtgctgctgatggcc
gccaagtttggcgtaccggtgtgcccccacgccggcggcgtggggctctgcgagtacgtg
cagcacgtctcgatcttcgactatatcgccgtatcaggctcgctggagggtcgcatcctc
gaatacgtcgaccacctccacgagcacttcgagcacccggtagtgatccgtaacggccac
taccaggtgcccaccgcaccgggctacagcattaccctcaagcccgcgtcactggcggaa
cacgtctatccggacggtcccgcctggcagacacactag

DBGET integrated database retrieval system