KEGG   Halorubrum sp. PV6: DOS48_04160Help
Entry
DOS48_04160       CDS       T05770                                 

Definition
(GenBank) glucose dehydrogenase
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
halp  Halorubrum sp. PV6
Pathway
halp00030  Pentose phosphate pathway
halp01100  Metabolic pathways
halp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:halp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DOS48_04160
Enzymes [BR:halp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     DOS48_04160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AZQ14087
UniProt: A0A3Q9EAR5
Position
852458..853528
Genome map
AA seq 356 aa AA seqDB search
MNAIAVYDGEGEPVVTEKPRPTPAAGEALVRTLRVGVDGTDHEVIAGGHGGSPEGEDHLV
LGHEAVGVVEDPNGTAFEVGDVVVPTVRRPPNGENEYFARGEPDMAPDGQYHERGIVGAH
GFMAEYFTTPEEFLIEIPPALAEWGFLVEPVSIAEKAIEHAYASRSAFQWAPESALVLGN
GSLGLLTVATLDESFERVYCLGRRERPDPTIDIIESLGATYVNSNETPVSSVPDAYEPMD
FVFEATGYAPHAFDTIEALAPNGVGALLGVPGDWEFEIDGGRLHREFVLHNKALVGSVNS
GYEHFEAAVDSLSRLSPGFLDDLVTGVYGLDEFEAAFADDDTTIKTAVEFDTYEKR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgatcgccgtgtacgacggggagggcgaaccggtcgtcacagagaagccgcga
ccgacgccggccgccggagaggcactcgtgcgaaccctgcgagtcggcgtcgacgggacc
gatcacgaggtcatcgccggggggcacgggggatcgcccgagggcgaagaccacctcgtc
ttggggcacgaggccgtcggcgtggtcgaagacccgaacgggacggcgttcgaggtcggc
gacgtcgtggtgccgaccgtcaggcgcccgccgaacggcgaaaacgagtacttcgcccgc
ggcgagccggacatggcgccggacggccagtaccacgagcgcgggatcgtcggcgctcac
gggttcatggcggagtacttcaccacgccagaggagttcttgattgagattccccccgcc
ctcgccgagtgggggttcctcgtcgaacccgtctcgatagcggagaaggcgatcgaacac
gcgtacgccagccggtcggcgttccagtgggcgccggagtccgcgctcgtgttggggaac
ggctcgctcggcctgttgaccgtggcgacgctggacgagtcgttcgagcgggtctactgt
ctcgggcggcgcgagcgtcccgacccgacgatcgacatcatcgagtcgctcggcgcgacg
tacgtcaactcgaacgagacgccggtctcgtccgtaccggacgcctacgagccgatggac
ttcgtcttcgaggcgacggggtacgcgccccacgcgttcgacaccatcgaggcgctcgcg
ccgaacggcgtcggcgcgctgctcggcgtgccgggtgactgggagttcgagatcgacggc
ggccggcttcaccgcgagttcgtcctccacaacaaggcgctcgtcggcagcgtcaactcc
gggtacgaacacttcgaggccgccgtcgactcgctgtcccgcctttcgcccggcttcctc
gacgatctcgtcaccggagtgtacgggctcgacgagttcgaggccgcgttcgcggatgac
gacacgactattaaaacggcggttgaattcgacacatatgaaaaacgttga

DBGET integrated database retrieval system