KEGG   Halorubrum sp. PV6: DOS48_06995Help
Entry
DOS48_06995       CDS       T05770                                 

Definition
(GenBank) glycosyl transferase family 2
  KO
K13693  glucosyl-3-phosphoglycerate synthase [EC:2.4.1.266]
Organism
halp  Halorubrum sp. PV6
Brite
KEGG Orthology (KO) [BR:halp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:halp01003]
    DOS48_06995
Enzymes [BR:halp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.266  glucosyl-3-phosphoglycerate synthase
     DOS48_06995
Glycosyltransferases [BR:halp01003]
 Others
  Glycosylglycerate
   DOS48_06995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AZQ14596
UniProt: A0A3S9LG72
Position
1430190..1431383
Genome map
AA seq 397 aa AA seqDB search
MEYVQERVTTLHALTDHRPAAPTGRAAVVVPMTEREYGTLAADRVLTALETVDPARVVVP
LRAAPDRVGPFADWLDGFDVDVETLWCGGPRLTELLASRGLDGSRGKGRDVWLGLGRALD
EEFVVVHDADTKTYSPAFVSRLLFPLANDHEFSKGYYARVEDNSLYGRLFRLFFRPLVRA
LGDATERREPSIMEYLDAFRYALAGEFAATTDLVSRCRIQRGWGLEVGTLGEAFAHAGFA
ESAQVDLGRYEHDHRSVDGPTGLADMSRAVGAATLRAVEGAGVAVEYDALADRYREAAER
LIRGYETDAAFNGLDYDRAAEREQVETYADALGEPGPDTRLPAWRTAPVTPSEVADAAQA
DLAAARESHADAAARPPEESDRRQSAEEAPETGTGED
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggagtacgtacaagagcgcgtgacgaccctccacgcgttgaccgaccaccggccggcc
gcgccgaccggccgcgcggcggtcgtcgtgccgatgacggaacgcgagtacgggacgctc
gcggccgaccgggtcctgacggcgctggagacggtcgaccccgctcgcgtcgtggtcccc
ctccgcgccgcccccgaccgcgtcggccccttcgccgactggctcgacggcttcgacgtg
gacgtggagaccctctggtgtggcggaccgcgcctcacggaactgctcgcgagccgcggg
ctcgacgggagccggggaaagggccgcgacgtgtggctcgggttgggtcgcgcgctcgac
gaggagttcgtcgtcgtccacgacgccgacaccaagacgtactcgcccgccttcgtctct
cggctcctcttcccgctcgcgaacgatcacgagttctcgaaggggtactacgcccgcgtc
gaggataactcgctgtacggccggctgttccggctgttcttccgaccgctggtccgcgcg
ctcggcgacgcgaccgagcgccgcgaaccgagcatcatggagtatctcgacgcgttccgg
tacgcgctcgccggagagttcgcggcgacgaccgacctcgtctcgcggtgccgcatccag
cgcgggtgggggttagaggtcggcacgctgggcgaggcgttcgcgcacgccggcttcgcg
gagagcgcgcaggtcgacctggggcggtacgaacacgaccaccgctccgtcgacggcccg
accggcctcgccgacatgagccgcgcggtcggcgcggcgaccctccgagccgtcgagggc
gcgggcgtcgccgtcgagtacgacgcgctcgccgaccgctaccgcgaggcggccgagcgg
ctgatccgcggctacgagacggacgccgcgttcaacggtctcgactacgaccgcgcggcc
gagcgcgagcaggtcgagacctacgccgacgcactcggcgaaccgggcccggacacccgc
cttccggcgtggcgaaccgcgcccgtgaccccgagcgaggtggctgacgcggcgcaggcc
gacctcgcggcggcgcgggagtcgcacgccgacgcggccgcgcgcccgccggaagagtcc
gaccgacgccagtcggccgaggaagcgcccgagaccgggacgggagaggactga

DBGET integrated database retrieval system