KEGG   Halorubrum sp. PV6: DOS48_11950Help
Entry
DOS48_11950       CDS       T05770                                 

Definition
(GenBank) tRNA (guanine(26)-N(2))-dimethyltransferase
  KO
K00555  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase [EC:2.1.1.215 2.1.1.216]
Organism
halp  Halorubrum sp. PV6
Brite
KEGG Orthology (KO) [BR:halp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:halp03016]
    DOS48_11950
Enzymes [BR:halp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.215  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase
     DOS48_11950
    2.1.1.216  tRNA (guanine26-N2)-dimethyltransferase
     DOS48_11950
Transfer RNA biogenesis [BR:halp03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    DOS48_11950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TRM MTS Methyltransf_25 PrmA Methyltransf_31 Met_10
Motif
Other DBs
NCBI-ProteinID: AZQ15487
UniProt: A0A3S9LIT5
Position
2403664..2404782
Genome map
AA seq 372 aa AA seqDB search
MDIEEGGLTVSVPEARDGASEGTGGGVFFNPTQELNRDITVAVLRAYRDREPRAASYLDA
MAASGVRGVRAAAEGYDVTCADVDPDAVELAAENLAANDLDGDTVHRDVNALLYENVFDV
VDLDPYGTPIPFADAALANARNLVCVTATDTAPLCGAHLQSGIRKYGAVPRNTDYHPEMG
LRTLISALVRTAARYDKAARPIVSHVSRHYARTYLELDSGAQAADACIDELGYVDHCEDC
LWREATRGLIADPVERCPVCDGDRVLTAGPLWLGPVADPDFTRAVRGHVTDDMGEAKRAR
KLLGTVARELDTPTHYDQHRLYKAWGEAAIGMDEFVERLRGAGHEASRAHYRGTAVKSGA
SIPEMRAAVLDD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggacatcgaggagggcggtctcaccgtttccgttccggaggcccgcgacggcgccagc
gagggcaccggcggcggcgtcttttttaaccccacccaagagctgaaccgcgacatcacc
gtcgcggtgctgcgcgcgtaccgcgaccgcgagccgcgagcggcctcgtatctcgacgcg
atggcggcctccggcgtccggggcgtccgcgccgccgccgaggggtacgacgtgacgtgc
gcggacgtggacccggacgcggtcgaactggccgccgagaacctcgccgcgaacgacctc
gacggcgacaccgtccaccgcgacgtcaacgcgctgttgtacgagaacgtcttcgacgtc
gtcgacctggacccgtacgggacgccgatccccttcgccgacgccgcgctggcgaacgcg
cgcaacctcgtctgcgtcacggcgaccgacaccgcccccctctgtggcgcccacttacag
agcggcatccgcaagtacggcgcggtcccgcggaacaccgattaccaccccgagatgggg
cttcggacgctgatctccgcgctggtccggaccgccgcgcgctacgacaaggcggcgcga
ccgatcgtgtcgcacgtctcgcgacactacgcgcggacctacctcgaactggactccggc
gcgcaggcggccgacgcctgcatcgacgaactcggctacgtcgaccactgcgaggactgc
ctctggcgcgaggcgacccgcgggctgatcgcggaccccgtcgagcgctgtcccgtctgt
gacggcgaccgcgtgctcaccgccggaccgctctggctcggccccgtcgcagaccccgac
ttcacccgcgccgtccgcggacacgtcaccgacgacatgggggaggcgaagcgcgcccgg
aagctgctcggaaccgtcgcccgcgaactcgacacgcccacccactacgaccagcaccga
ctgtacaaggcgtggggcgaggcggccatcgggatggacgagttcgtcgagcgcctccgg
ggcgcgggccacgaggcgagccgcgcgcactaccgcgggaccgcggtcaaaagcggcgcg
tcgatcccagagatgcgcgcggcggtcctcgacgactga

DBGET integrated database retrieval system