KEGG   Halorubrum sp. PV6: DOS48_12890Help
Entry
DOS48_12890       CDS       T05770                                 

Gene name
metX
Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
halp  Halorubrum sp. PV6
Pathway
halp00270  Cysteine and methionine metabolism
halp00920  Sulfur metabolism
halp01100  Metabolic pathways
halp01110  Biosynthesis of secondary metabolites
halp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:halp00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    DOS48_12890 (metX)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DOS48_12890 (metX)
Enzymes [BR:halp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     DOS48_12890 (metX)
    2.3.1.46  homoserine O-succinyltransferase
     DOS48_12890 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Esterase Tannase
Motif
Other DBs
NCBI-ProteinID: AZQ15664
UniProt: A0A3S9LJA5
Position
complement(2580809..2582107)
Genome map
AA seq 432 aa AA seqDB search
MSAVETDHGVASLGEFTFECGQSVPDLEVAYETHGEFDGDNVVLVCHALTGSQNVARSPA
PERDDATRGAGQAGQARAWWDDIVGPGKAIDTTEYYVVCANVPGSCYGTTGPASERPADL
DLPSEPDHDRWGTAFPPVQVEDWARAQRRLLDHLGVGRLRAVVGGSVGGMNAVEWAKRYP
DDVDRVVAIATAGRLDAQCLALDAVARRAIRADANWNEGHYYGEGKPSPDEGLALARQIG
HIMYLSKASMERKFGRRSAGRDSLTREEGDLGLPPEPTAGFFPYREVESYLDYQAEGFSD
RFDANSYLYLTRAMDEYDLAAGHGSDADALAAFEGEALLMSFTADWHFTVEQSASLADAF
RVGDIPVAHHVIDSDHGHDAFLVEPEHVGPPLRDFLAEGTSGRAVSDDGGDGDDSARPEP
DHAPVHASLFKG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgtcgaaaccgaccacggcgtcgcctcgctcggggagttcaccttcgagtgc
gggcagtcggtcccggatctcgaggtcgcctacgagacccacggcgagttcgacggcgac
aacgtcgtcttggtctgtcacgcgctcaccggcagccagaacgtggcccgctctcccgcg
cccgagcgcgacgacgccacccgcggcgccgggcaggccgggcaggcccgcgcgtggtgg
gacgacatcgtggggccggggaaggcgatagacacgaccgagtactacgtcgtctgcgcg
aacgtccccggctcctgttacggcacgacgggtccggcgagcgagcggcccgccgacctc
gacctcccgtccgagcccgaccacgaccgctgggggaccgcgttcccgccggtgcaggtc
gaagactgggcgcgcgcacagcgccgcctcttggaccacctcggcgtggggcggctccgc
gccgtcgtcggcggcagcgtcggggggatgaacgccgtcgagtgggcgaaacgctacccg
gacgacgtcgaccgcgtggtcgccatcgcgaccgcggggcggctcgacgcgcagtgtctc
gcgctcgacgccgtcgctcgacgggcgatccgtgcggacgccaactggaacgagggccac
tactacggcgaggggaagccgtcgcccgacgaagggctcgccttggcccgccagatcggg
cacatcatgtacctctcgaaggcgtcgatggagcggaagttcgggcggcgctcggcgggc
cgcgactcgctgacccgcgaggagggcgacctcgggctcccgccggagccgacggcgggc
tttttcccgtaccgcgaggtcgagtcgtacctcgactaccaggccgaggggttcagcgac
cggttcgacgccaacagctacctctacctcacgcgggcgatggacgagtacgacctcgcc
gcgggccacgggagcgacgccgacgcgctcgccgcgttcgagggcgaggcgctgttgatg
agtttcacggccgactggcacttcacggtcgagcagtcggcgtcgctggccgacgcgttc
cgcgtcggcgacatcccggtcgcacaccacgtgatagactccgaccacggccacgacgcg
ttcctcgtcgaacccgaacacgtcgggccgccgcttcgtgacttcctcgccgaggggacc
tcgggtcgcgccgtctcggacgacggcggcgacggggacgactccgcgcggccggagccc
gaccacgcgcccgtccacgcgagcctttttaagggatag

DBGET integrated database retrieval system