KEGG   Halocella sp. SP3-1: D7D81_10735Help
Entry
D7D81_10735       CDS       T05769                                 

Definition
(GenBank) glycine--tRNA ligase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
hals  Halocella sp. SP3-1
Pathway
hals00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:hals00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D7D81_10735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hals01007]
    D7D81_10735
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hals03016]
    D7D81_10735
Enzymes [BR:hals01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     D7D81_10735
Amino acid related enzymes [BR:hals01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   D7D81_10735
Transfer RNA biogenesis [BR:hals03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    D7D81_10735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AZO95027
UniProt: A0A3S9H148
Position
2260769..2262826
Genome map
AA seq 685 aa AA seqDB search
MSRELLFEIGTEELPANYMSTVRKDFKNLTEKTFENKRLVFDDCQVYSTPRRLTLYMKGL
TEKQENKSESLRGPAKSIAFDKAGKPTKAALGFARGQGVDIDELIIRDGYLYLERVIEGK
KTVDILADVFLSIINKMNFPKAMRWGNSTERFIRPIRWLLLLFGEEKIDFSFAGIESDKK
TYGHRFLTDKAITIDNPAEYFSKLEDAYIVVDHNKRKELILKQIKDLSLTEGNVLVDEEL
LSEVIELIEYPTTFFGSFEREYLKLPEEVLTTSMMEHQRYFPVVDKNDNLLPYFVFVRDG
AEEYIDEVRYGNEMVLRARLADARFFYDEDLKLSPVDRREKLKDIVYQEKLGSMYDKVQR
IKSIASKMAVSFELTAEQIDILKRAAELSKNDLVTEMVNEFSKLQGIVGKEYALVNEESR
EVAEAIFEQYLPRYAGDSLPETVYGQIISIADKIDSIVGHFSLGHIPSGSQDPFALRRQA
SGIVKIIIEKDLNLKLDTLISYTFEVMNKQDEKLLQEIKDFLVQRVNNILEEKGIRYDII
KAVIAVNNNDPVDLMDRAEAVMELREDNPALFIDLVRGLVRAKNLASKAEKEYNIDKGLL
KENAELDLYKSYLEFSGEINTMFSQGNYLSGLKRFVELKAAIDNFLDNVIVMVEDEDIKN
NRLALLQKVSALITGVMDIDSIALD
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgtctagagagctattatttgaaataggcacagaagaactacctgctaactatatgagt
acggtcaggaaagactttaaaaatctaactgaaaaaacatttgagaataaaaggcttgtt
tttgatgattgtcaggtatattcaacaccaaggcgattaactctttacatgaaaggttta
actgaaaagcaggaaaataaaagtgaatccctcagaggccctgccaagagtattgccttt
gataaggctggcaaaccaactaaagctgctcttggttttgcccgcggacagggggtagat
attgatgaacttattatcagggatggttacctctatcttgagcgtgttattgaaggcaaa
aaaacagtagatatattagctgatgtttttttaagtattattaataaaatgaactttccc
aaggctatgcgttgggggaatagtacagagaggtttatcagacctatcaggtggttgtta
ttattattcggtgaggaaaaaattgatttttcttttgctggaatagaatctgataaaaag
acctatggacatcggtttttaactgataaagctattactatagataatccagcagaatat
ttttctaaactggaagatgcctatatagttgttgaccataataaaagaaaggagttaata
ttaaaacaaataaaggatttatcccttactgaaggaaatgttcttgtagatgaagaatta
ctttctgaggtaatagaacttatagaatacccaactacttttttcggtagttttgagagg
gagtatttaaaactaccagaagaggtattaacaacttcaatgatggaacaccaacgatat
tttcctgtagtagataaaaacgacaatttattaccctattttgtgtttgttcgagatggt
gcagaggagtatattgatgaggtacgatatggtaatgagatggttttaagggccagactg
gcagatgcccgttttttctatgatgaggacttaaagctcagcccagtagataggcgggaa
aaacttaaagatatagtttatcaggaaaaactgggtagtatgtatgataaggtgcaacgt
attaaatctattgcctcaaaaatggctgtctcttttgaacttactgctgaacagatagat
attttaaaaagggcagcagaactgagtaaaaatgatctggttactgaaatggtcaatgaa
ttttcaaaacttcagggtattgtggggaaggaatatgccctggtaaatgaagagagtagg
gaagttgctgaggcgatttttgaacaatatctaccccgttatgctggtgatagcctccct
gagactgtttatgggcagataatcagcattgctgataaaattgatagtattgtaggacac
tttagtctaggtcacatcccgagtggttcacaggatccttttgctttacgacgtcaagct
tcaggtatagtaaaaattatcattgaaaaagacctgaatcttaaacttgacaccttaatc
agctacacttttgaggttatgaataagcaggatgaaaaactattacaggaaataaaggat
tttctggtacagagagttaataatatattagaagaaaagggtatcagatatgatattatt
aaagctgtcatagcagtcaataataatgacccagtggatcttatggatcgggcagaggca
gttatggaattgagggaggataatcctgccttatttattgatctggttagaggtcttgtg
cgggcgaaaaaccttgccagcaaggctgagaaggaatataacatagataagggcttgtta
aaagaaaatgctgaacttgatttatataagagttatctggagtttagtggtgagataaat
acaatgtttagccagggaaattatctgtctggtctaaagagatttgtagaattgaaggcg
gctattgataattttcttgataatgtaatagtgatggttgaagatgaagatataaaaaat
aatcgattggcattattacaaaaagtgagcgctttgattactggggtaatggatatagat
agtattgctttagattag

DBGET integrated database retrieval system