KEGG   Halocella sp. SP3-1: D7D81_15595Help
Entry
D7D81_15595       CDS       T05769                                 

Definition
(GenBank) methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
hals  Halocella sp. SP3-1
Pathway
hals00630  Glyoxylate and dicarboxylate metabolism
hals00660  C5-Branched dibasic acid metabolism
hals01100  Metabolic pathways
hals01120  Microbial metabolism in diverse environments
hals01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hals00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    D7D81_15595
   00660 C5-Branched dibasic acid metabolism
    D7D81_15595
Enzymes [BR:hals01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     D7D81_15595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C MR_MLE_N Enolase_C
Motif
Other DBs
NCBI-ProteinID: AZO95898
UniProt: A0A3Q9B8Z4
Position
complement(3260741..3261994)
Genome map
AA seq 417 aa AA seqDB search
MKQIKNVIASPGLTGFFFDDQAAIKNNAVEDGATYYGKIETPGFSNIRQAGESISIMLIL
DDGQVAYGDCAAVQYSGTGGRDPLFLAKEFISIINKEIAHLLIGKDLKSFKSLAELVDNY
SKNGCTLHTAIRYGVTQALLDAVAKAKYCTRTEVVLQEYGLKSILKPIPIFCQTGDDRYL
NADKIIIKHADVLPHGLINNVDTKLGKHGEKLLGYIKWLKERIKKIGDENYEPIFHVDVY
GTIGLAFNNNLEEMVDYLLDLEKVSSPFKIRIEGPVDAGSKTEQIKSLKLLRNSLKESNS
SVEIVADEWCNSLEDIKDFVDAEAADMVQIKTPDLGGINNIIEAVLYCKQHGIGAYQGGT
CNETDRSAQICTDIALATRPNQVLAKPGMGVDEGLMIVYNEMQRILTLLKYKDSQGV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaattaaaaatgtaattgcttccccagggctgacaggttttttctttgatgat
caggcagcgattaaaaataatgcagttgaagatggtgcaacatactatggaaaaatagaa
acccctggttttagtaatattaggcaggcgggtgaatcaatttcaattatgcttattctt
gatgatgggcaagttgcatatggcgattgtgctgctgtccaatattctggaacaggtgga
agagaccctttgtttctggccaaggaatttatctctataattaataaagaaattgcccat
ttattgattggtaaggatttaaaaagttttaaatccttggcagaattagttgataattat
tctaaaaatggttgtacgctacatacggctattcgatatggtgttactcaggcccttctt
gatgcagttgctaaggcaaaatattgtaccagaacagaagttgtccttcaagagtatggt
ctaaaaagcattttaaaaccaatacctattttttgtcagactggtgatgacagatatttg
aatgcagataaaattattattaaacatgctgatgttttacctcatggtttaataaataat
gttgatacaaaacttgggaaacatggtgaaaaactactgggttatattaaatggttgaag
gagagaattaaaaagataggtgatgaaaactatgaacctatttttcatgtggatgtttat
ggaactattggtttagcatttaataataatttagaagaaatggtagattatttgcttgat
ttagaaaaagtatcctctccttttaagataaggatagaaggacctgttgatgcaggcagt
aaaacagaacagataaagagtttaaagcttttaagaaatagcttaaaggaatctaatagt
agtgtggaaattgtcgctgatgaatggtgcaactctctggaagatataaaagattttgtt
gatgctgaagccgctgatatggttcaaattaaaacccctgacctggggggaataaataat
ataatagaagctgtcctatattgtaaacaacatggtataggggcttaccaggggggaacc
tgtaatgaaacagatcgttctgcccagatttgtactgatatagctttagcaaccaggcca
aatcaagttcttgctaaaccaggcatgggagttgatgaaggtttaatgattgtttataat
gaaatgcaacgtattctaactcttttaaaatataaagatagtcagggggtctaa

DBGET integrated database retrieval system