KEGG   Halocella sp. SP3-1: D7D81_15705Help
Entry
D7D81_15705       CDS       T05769                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
hals  Halocella sp. SP3-1
Pathway
hals00860  Porphyrin and chlorophyll metabolism
hals01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hals00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D7D81_15705
Enzymes [BR:hals01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     D7D81_15705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase Peptidase_S51 Peptidase_C26 DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AZO95918
UniProt: A0A3Q9BAH0
Position
complement(3284127..3285644)
Genome map
AA seq 505 aa AA seqDB search
MAAKSIMIQGTGSDVGKSVITAGLCRLLVRDGYQVAPFKSQNMALNSFITRDGGEIGRAQ
AVQAEAARVVATVDMNPVLLKPNQDDNSQLIIHGQAVKNIKAKEYFADQGKSLEAIEESL
QRLAGKWEIIVMEGAGSPAEINLREYDLVNMKIAEMIDAPVILVADIDKGGVFASIVGTL
ELLTQEERERVKGIIINKFRGDQARFEGGIDFIEKYTGKPVLGVIPYLKDIKIPEEDSLA
QDVQGDTDYQLDIVILYLPHISNFTDFDLLAAEPETRVRYLRELTEIGEPDLIIIPGSKN
TIEDLQYLYSQGYIEVIRQKYRQGIPVLGICGGYQMLGRRVIDPSHVESSEEVVAGLGLL
EMETVYAGEKISRQVKASINTDISFFKDLQGEVLTGYEIHHGRSRIDSDQNQLLKIMLWG
DKGESFDDGLISDDGLVWGTYLHGIFDNDRFRRSFINHIREKKGLHPLSRQHMSSRRLRE
DAYDRFADLLEKNIARAKLDRVIFG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaaatctattatgatacagggaacaggttctgatgtgggcaaaagtgtcatt
acagcaggtctctgtcgtttgctggttcgtgatggttaccaggtggcacctttcaaatca
cagaatatggctttaaattcttttattaccagggatggtggtgaaattggcagggcccag
gctgtacaggctgaggcagccagggtagtagcaactgttgatatgaatccagtcttatta
aagcccaatcaggatgataattcccagctcattattcatggccaggcagtaaagaatata
aaggctaaagagtattttgcagaccagggaaaatccttagaggctattgaggagtccctg
caaaggctggccggaaagtgggaaattattgttatggaaggggcagggagtcctgctgaa
attaatctgcgggaatatgacctggttaatatgaaaatagctgaaatgatagatgccccg
gtaatcctggtagctgatattgataaaggaggggtttttgcctctattgtaggtaccctg
gaattacttactcaggaggagagagagcgggtaaaggggattataattaataaatttcgc
ggggaccaggcccgttttgaaggagggatagactttattgaaaaatataccggcaaacca
gtcctgggtgttatcccttatttgaaagatattaagatacctgaagaagacagtcttgct
caggatgtccagggtgatactgattaccagcttgatattgtaattctatatctaccccac
atttctaattttactgattttgacctgctggctgctgaacctgaaaccagggtaaggtat
ttacgggagctaactgagataggtgaaccagacttaattattatccccggcagtaagaat
actatagaggatttacaatatctctacagtcagggttatattgaagtcatcaggcaaaag
tacagacaggggataccggtgcttggtatttgtggtggttatcagatgcttgggagaagg
gttattgacccttcacatgttgaatccagtgaagaagttgttgctggactaggccttctg
gaaatggaaacagtttatgctggggaaaagataagcagacaggttaaagccagtataaat
actgatatttctttttttaaagatttacagggtgaggtactaacaggctatgagatccat
catgggaggagtcgtattgatagtgatcaaaatcagttgctgaagattatgctctgggga
gataagggagagagtttcgatgatggtttgataagtgatgatggtctggtctggggtact
tatctccatgggatatttgacaatgaccgatttaggaggtcttttatcaatcacataagg
gagaaaaagggtttacaccctttaagcaggcagcatatgtcttcccggcgtctgcgggaa
gatgcctatgatagatttgctgacctgttggaaaaaaatatagcaagagcaaaactggac
agggtaatttttgggtga

DBGET integrated database retrieval system