KEGG   Halocella sp. SP3-1: D7D81_18730Help
Entry
D7D81_18730       CDS       T05769                                 

Gene name
trpD
Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
hals  Halocella sp. SP3-1
Pathway
hals00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hals01100  Metabolic pathways
hals01110  Biosynthesis of secondary metabolites
hals01130  Biosynthesis of antibiotics
hals01230  Biosynthesis of amino acids
Module
hals_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hals00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    D7D81_18730 (trpD)
Enzymes [BR:hals01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     D7D81_18730 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AZO96463
UniProt: A0A3S9H5L3
Position
complement(3902447..3903472)
Genome map
AA seq 341 aa AA seqDB search
MREVINKVINGDNLTLEESISVMADIMEGKATPAQIASYITALRIKGETIEEITGAAMVM
RKKAAGIPVASRGLIDVCGTGGDSLNTFNISTVTAFVLAGAGLLVAKHGNRSVSSTCGSA
DLLEKLGVNINLEPRQVGRCIDEIGIGFLFAPVFHQAMKYAVKPRREIGIRTIFNVLGPL
TNPAGAELQLLGVYDPDLTEPVAYVLKNLGVKAALVVHGIGGMDEITTTGKTRVSQLTDG
KVQTYYLDPLELGLETAAIEELAGGSPDENARIARDILHGHQDKKRDIVLLNSAAALVIA
EKVDNFKDALNLAAEAIDSGAALKKLNQLQELSAQLAGVAI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
ttgagagaagtgattaataaggtgattaatggagataatctgactttagaggagagtatc
tcagttatggctgatattatggaaggaaaagctacaccagctcagatagcttcctatatt
actgctttaagaataaagggagagacaattgaagaaataaccggtgcagctatggttatg
aggaaaaaagcagccggaataccagtagcaagcaggggcttgatagatgtctgcggtaca
ggtggtgacagtttaaatacctttaatatttctacggtaactgcctttgtcctggccggg
gctggtctgttggttgccaaacacgggaatcgttcagtatccagtacctgtggcagtgca
gatctcctggaaaaactcggggtaaatattaatctagaacccaggcaggtaggtagatgt
attgatgagatagggattggatttttgtttgcccctgtttttcatcaagccatgaaatat
gccgtaaaaccccgccgggagatagggatcaggactatttttaatgtcctggggccttta
accaaccctgctggagcagaactacaactgcttggtgtgtatgaccctgatttaacagaa
cctgtggcctatgtactgaaaaacctaggggttaaggcggccctggttgtacatggaata
ggtggtatggatgaaataacaactactggtaaaaccagggtcagccaacttactgatgga
aaggttcagacatattatcttgatccactggaactgggcttagaaactgctgcaattgag
gaattggctggtggttctcctgatgaaaatgccaggatagccagggatattctacatggc
caccaagacaaaaaaagggatattgtcttattgaattcagcagctgccttagttattgct
gaaaaagttgataattttaaagatgcattaaatttagctgccgaggcaattgatagtggg
gcagccttaaagaaattaaatcaacttcaggagctgtcagctcaacttgcaggggtggct
atataa

DBGET integrated database retrieval system