KEGG   Halomonas sp. R57-5: HALO0096Help
Entry
HALO0096          CDS       T04029                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ham  Halomonas sp. R57-5
Pathway
ham00071  Fatty acid degradation
ham00072  Synthesis and degradation of ketone bodies
ham00280  Valine, leucine and isoleucine degradation
ham00310  Lysine degradation
ham00362  Benzoate degradation
ham00380  Tryptophan metabolism
ham00620  Pyruvate metabolism
ham00630  Glyoxylate and dicarboxylate metabolism
ham00640  Propanoate metabolism
ham00650  Butanoate metabolism
ham00900  Terpenoid backbone biosynthesis
ham01100  Metabolic pathways
ham01110  Biosynthesis of secondary metabolites
ham01120  Microbial metabolism in diverse environments
ham01130  Biosynthesis of antibiotics
ham01200  Carbon metabolism
ham01212  Fatty acid metabolism
ham02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ham00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HALO0096
   00630 Glyoxylate and dicarboxylate metabolism
    HALO0096
   00640 Propanoate metabolism
    HALO0096
   00650 Butanoate metabolism
    HALO0096
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HALO0096
   00072 Synthesis and degradation of ketone bodies
    HALO0096
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HALO0096
   00310 Lysine degradation
    HALO0096
   00380 Tryptophan metabolism
    HALO0096
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HALO0096
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HALO0096
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HALO0096
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ham04147]
    HALO0096
Enzymes [BR:ham01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HALO0096
Exosome [BR:ham04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HALO0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CEP33778
UniProt: A0A0D6E204
Position
I:complement(94209..95444)
Genome map
AA seq 411 aa AA seqDB search
MTRGHYTAFEDTHLVAAVRTPFTDLNGALGAISPTDLGIKVAKEVLNVSGVAPTDVDSVI
AGSVAQASFDAYLLPRHIGLYAGVPQEVPALHAQRVCGTGFELLKQAAEQIALGQARCVL
CVGTESMTRNPIAAYTHRGGFRLGAPVAFKDFLWEALMDPAPNVSMIQTAETLAQRYVIT
REQVDAYAERSFSLAVEAQSQGVLSADIIAVGNETFSLAGYSDRRIQLPRKIIRVDQDTH
IRPSPRQVLSQLSPVYDGGLQTAGNSAAVVDGAAAALVMAGSHAAKSSLARLCATAVVGV
APEIMGIGPAPAIRLLLECSGLTLNDIDRLEINEAQGAQVLAVARELDLDLTKLNVHGGA
IAIGHPLAATGLRLAMSLARQLKRDGLRYGIAAACIGGGQGMAILLEHSAE
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcgggcactacacggcatttgaggatacccatttagttgccgctgtacgcaca
ccgttcaccgacctgaacggtgcgctgggggcgatctcgcccactgacctgggcatcaag
gtcgccaaggaagtgctcaacgtgagcggtgtggcaccgacagacgttgattcagtgatc
gctggatccgtggcccaagcgagtttcgatgcctatttacttcctcgtcatattgggttg
tatgcgggcgtcccccaggaggttcctgccctgcacgcgcagcgcgtctgcggcaccggc
tttgaactgttgaaacaagccgcggaacagattgcgctcggacaagccaggtgcgtgctg
tgtgtcggcacggaatccatgacccgcaacccgattgcagcctacacgcatcgcggcgga
ttcaggcttggcgcaccggtggccttcaaagacttcctatgggaggcgctaatggatccg
gcacccaatgtatcgatgattcagaccgccgaaaccttagcgcagcgctacgtcatcact
cgcgagcaggtagatgcctacgccgagcgcagcttctccctagcggtcgaagcccaatcg
caaggtgtcctctctgcggatatcattgcggttggaaacgaaaccttctccctcgccggc
tatagcgataggcgcattcagctaccgcgtaaaatcatccgcgtagaccaggatacccat
attcggccttcgcctcggcaggtgttgagtcaattatcgccggtatacgatgggggcctt
caaacggcaggtaacagcgccgccgttgtcgacggcgcagcagcagcgctggtgatggca
ggttcgcacgcagccaagtcatctctggcgcgcctctgcgccacggccgtggttggcgta
gcgcccgaaatcatgggtatcgggcccgcccccgccattcggctactgctagaatgcagc
ggcctcactctcaatgatatcgaccgcctcgaaatcaacgaggctcagggtgcacaggtg
ctcgcagtcgcccgtgagctggatctcgacctaaccaagctcaacgttcatggcggagct
atcgccattggccacccattggccgcaacgggtttgcggctagcaatgtccttggcccga
caactcaagcgagatggcttgcgctatggcatagcagcagcttgcattggcggcggtcaa
ggcatggccattctgcttgagcactcagccgaataa

DBGET integrated database retrieval system