KEGG   Halomonas sp. R57-5: HALO0115Help
Entry
HALO0115          CDS       T04029                                 

Definition
(GenBank) Putative amidase IacH
  KO
K01426  amidase [EC:3.5.1.4]
Organism
ham  Halomonas sp. R57-5
Pathway
ham00330  Arginine and proline metabolism
ham00360  Phenylalanine metabolism
ham00380  Tryptophan metabolism
ham00627  Aminobenzoate degradation
ham00643  Styrene degradation
ham01100  Metabolic pathways
ham01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ham00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    HALO0115
   00360 Phenylalanine metabolism
    HALO0115
   00380 Tryptophan metabolism
    HALO0115
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HALO0115
   00643 Styrene degradation
    HALO0115
Enzymes [BR:ham01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     HALO0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CEP33797
UniProt: A0A0D6E2R7
Position
I:117080..118207
Genome map
AA seq 375 aa AA seqDB search
MPSLIQHLGLGTGSKRVVVKDSIDIAGYPTRAGSAALADAPAAERHAEIVERTLAAGYRI
VGKANLHELAFGMTGLNALTGTPENPRFPALIPGGSSSGSAAAVAAGLAEIGIGTDTGGS
IRVPAACCGVVGLKPTFGRLSRRGVMPAYSSLDCVGPLSANLEDLIDFMSAVDAEFTVVS
GAAMPRLGRLDVEADGAILGTLEAYLEGTGLATEKCALPMMSEAFDAAMALINRETYSAC
GAWLDSGRLGSDVERRLRAAAKISDAELHEAEAVRQAFTAEVDRLLETCDVLVLPTLPHF
PLSRAAAEEGQQDLTISSLVRPFNLSGHPALSLPLPPSRGQPVSLQLIGRRGDDAGVCRA
ARYLVEALHDKTIQK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgccatctctcatccagcatctcggcttaggcacaggctccaagcgagtcgtggttaag
gacagcatcgatatcgccggctacccgacccgtgcaggttctgcggcgctggccgatgcg
ccggcggcagagaggcatgccgagatcgtcgagcgcacgctggcggccggttatcgcatc
gtcggcaaagccaatctgcatgaactggcgtttggcatgaccgggctcaatgccttgacg
ggcacccctgagaacccgcgctttccggcgttgattcccggcgggtcgtccagcggttcg
gcagcggcggtggcagcggggctggcggagataggcatcggtaccgataccggcggctcg
attcgggtgcccgcggcctgctgcggggtggtcggcttgaagcctacgttcggtcggctt
agtcggcgcggcgttatgcccgcctacagcagcctggactgcgtagggccgctgagtgcc
aatctcgaggatttgatcgacttcatgtcagccgtggatgcggagtttacggtcgtaagc
ggcgcagcgatgccacgcctaggcaggctagacgtcgaggccgatggcgcaattctcggc
acgctggaagcgtatctcgaaggtactgggctggccactgaaaagtgcgccttgccaatg
atgagtgaggcttttgatgccgccatggcgctgatcaaccgtgaaacctatagcgcttgt
ggtgcctggctcgatagcggccgcttagggagtgacgtggagcgccgcctgcgcgcggcc
gccaagatttccgacgccgagctgcacgaggccgaagcggtgcgccaggcattcactgcc
gaggtggatcggctgctcgagacgtgcgatgtgctggtgttgccgacgttgccgcacttt
ccactgagccgcgcggcagccgaggagggacagcaggatctgaccatctcctcccttgta
cgaccttttaatctttcgggacacccggccttgagcttgccactgcctccgagccggggc
cagccagtgagcctgcaactcattggcaggcgaggcgacgacgccggtgtctgccgagcc
gcgcgctatctggtcgaggctctgcatgacaagaccatacaaaaatag

DBGET integrated database retrieval system