KEGG   Halomonas sp. R57-5: HALO1283Help
Entry
HALO1283          CDS       T04029                                 

Definition
(GenBank) Protein associated with Co2+ and Mg2+ efflux
  KO
K06195  ApaG protein
Organism
ham  Halomonas sp. R57-5
Brite
KEGG Orthology (KO) [BR:ham00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    HALO1283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: CEP34965
UniProt: A0A0D6E5Y5
Position
I:1396245..1396622
Genome map
AA seq 125 aa AA seqDB search
MSGLAIKVSVVPSYRADESNDGESRYVFSYTVTVHNQSPHSVQLMARYWKITQGGGEYQE
VRGKGVVGQQPLIGPGQSFRYTSRAILQTPVGVMEGAYTLLDTSTQRVFEVAITPFRLAV
PLQLH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggcctggcgatcaaggtaagcgttgtgcctagctatcgtgccgatgagtctaac
gacggcgagtcgcgctacgtgttcagttacaccgtgaccgtgcacaatcaaagcccccac
agcgttcagcttatggcgcgctactggaaaatcacccagggcggaggcgagtaccaagaa
gtgcgcggcaaaggcgttgtcggccagcagccgctgatcggtcccggccaaagctttcgc
tacaccagccgggcgattctccagaccccggtgggcgttatggaaggcgcctatacgctg
ttagacacctccacccagcgtgtttttgaggtggcgattacgccatttagattggccgta
cctcttcagctccactag

DBGET integrated database retrieval system