KEGG   Halomonas sp. R57-5: HALO1495Help
Entry
HALO1495          CDS       T04029                                 

Definition
(GenBank) Methylmalonate-semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
ham  Halomonas sp. R57-5
Pathway
ham00280  Valine, leucine and isoleucine degradation
ham00410  beta-Alanine metabolism
ham00562  Inositol phosphate metabolism
ham00640  Propanoate metabolism
ham01100  Metabolic pathways
ham01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ham00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    HALO1495
   00562 Inositol phosphate metabolism
    HALO1495
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HALO1495
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HALO1495
Enzymes [BR:ham01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     HALO1495
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     HALO1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh p6
Motif
Other DBs
NCBI-ProteinID: CEP35177
UniProt: A0A0D6E6P3
Position
I:1642686..1644185
Genome map
AA seq 499 aa AA seqDB search
MSVREIPMYIDGQPVQSQSQEWRDVVNPATQEVVARVPFCTTDEVERAISSAKEAFKEWR
KVPLGKRMRIMLKLQALIRDNTAELAALITEEHGKTLPDAEGEVGRGLEVVEHACSITSL
QLGELAENAANEVDVYTMHQPLGVGAGITAFNFPIMLPCFMFPLAIATGNTFVLKPSEQD
PSSTMRLVELAHEAGVPAGVLNVVHGGPDVANQIADHQDIKALSFIGSTHVGSLLYNRAA
AAGKRMQAMMGAKNHCVVMPDANRSQAINNLLGSAFGAAGQRCMANSVVVLVGEAREWLS
DIVDAAREMKVGPGTQRDADLGPLVSPAARDRVLRLIDAGEQEGAKLMVDGRNVQVEGYP
NGNFVGPTLFADVKADMTIYREEIFGPVLCVVSVETLDEAIAFINANPNGNGTSIFTNSG
WVARRFETDIDVGQIGINVPIPVPVAYFSFTGSRASKLGDLGPNGKQAIAFWTQTKTVTA
RWFEPENVSSGINSTISLG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttcgcgaaattcccatgtatatcgatggccagcccgtgcagtcgcaaagccag
gagtggcgcgatgtggttaaccccgccacgcaagaggtggtagcgcgggtaccgttctgt
accactgacgaagtggagcgcgctatcagcagcgctaaagaggcgtttaaggagtggcga
aaagtaccgctgggtaaacgcatgcgcattatgctcaagcttcaggcactgattcgcgac
aataccgcagagttggcggcgctgatcaccgaagagcacggcaaaacgcttcccgatgcg
gaaggggaagttggccggggcttggaagtggtggagcatgcctgttcgattacctcgctg
cagttgggtgagctggcggaaaatgccgctaacgaggtggacgtttacactatgcaccag
ccgcttggggtgggcgccggtattactgcctttaacttcccgattatgctgccgtgcttt
atgtttccactggcgattgccactggtaataccttcgttcttaaaccctccgaacaggat
cccagttccaccatgcgcttagtggagttagcccacgaagccggtgtcccggcaggcgtg
ctcaacgtggtgcacggtggccctgatgtagccaaccaaatcgctgatcaccaggatatc
aaagcgctctcgttcatcggctctacccatgtgggttcgctgctgtataaccgtgcagcg
gcagcgggcaagcgcatgcaagcaatgatgggggccaagaaccactgcgtggtcatgccc
gatgctaatcgtagccaagcgatcaacaacctgctgggctcagcctttggcgcggcgggc
caacgctgcatggcaaactctgtggtggtgctggtgggcgaggcgcgtgagtggctgagc
gatatcgttgatgcggcgcgtgaaatgaaagtcggcccgggcacccaacgcgatgcggat
ttaggcccgctggtatcaccagctgctcgtgaccgcgtgctgcgtttaatcgatgcgggg
gagcaagagggtgccaaactgatggtcgatgggcgcaatgttcaggtggagggttatccc
aacggcaattttgtcgggccgactctgtttgctgacgtaaaggcggatatgaccatttac
cgggaagagatttttggtcccgtgctgtgcgtggtgagtgttgaaacgctggatgaggcg
attgcctttatcaatgccaaccctaacggcaacggtacctctatctttacaaactcgggt
tgggtagcgcgccgctttgaaaccgatatagacgttggccaaattggtatcaacgtgcca
attccggtgccggttgcctatttcagtttcaccggctcgcgggcttcgaaactaggtgat
ttaggccctaacggtaagcaggcgatcgcgttctggacacaaaccaaaacggtgacggca
cgttggtttgagccggaaaacgtatccagcggtatcaacagcaccatttcgcttggctaa

DBGET integrated database retrieval system