KEGG   Halomonas sp. R57-5: HALO1666Help
Entry
HALO1666          CDS       T04029                                 

Definition
(GenBank) Exodeoxyribonuclease V, subunit gamma
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
ham  Halomonas sp. R57-5
Pathway
ham03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ham00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    HALO1666
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ham03400]
    HALO1666
Enzymes [BR:ham01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HALO1666
DNA repair and recombination proteins [BR:ham03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     HALO1666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: CEP35348
UniProt: A0A0D6E6H3
Position
I:complement(1799628..1803245)
Genome map
AA seq 1205 aa AA seqDB search
MSANSLLTQTPLTPGFMVVHANRLEDLRGLAVEWMRRHPLSPLENETILVQSNGIGQWLK
LALAEDPAQGGAGIAAALNVTLPARFLWQAYRTVLTQLTNDDHAVPETSPFDKSRLIWRL
LRLLPSLAEQEAFAPLARFLEVDRDQRKHYQLAERLADLFDQYQVYRADWLDAWAKGNDV
LITARGEARPLEEHQLWQPELWRALRDDVANNLGDAGLNSSRAQVHSRFLEAAVQLEGQA
CPPGLPRRLIIFGISSLPQQTLEALAALSRCCQIVLCVHNPCQYYWADIIEHKDLLRASR
YRQQRKAGMPDALDVLGTGDASDALHLHAQPLLAAWGKQGRDYLRLLDEHDDAGNYQTLF
EQQALRIDMFEPFSGEERNCLLSQLQDDIRELRPVAETQTHWPALDPVSDDSIVFHIAHG
PQREVEILHDQLLAAFSADPDLRPRDIIVMVPDIDRYAPHIEAVFGQYRSAFGSYNANAR
PDDPRYIPYTLSDQASRHRLPMMIALEKLLRLPELRLSVSDLLDLLEVPALRTRFGIDEH
DLPTLSRWIEGAGIRWGLNAEQRTRLDLPEGLTQNTWAFGLRRLLLGYTVGSAEAWQGIE
PFDDIGGLEASLAGPLANLLEKLESTWKTFCQPTDAASWVARLRELLETYFLTDDAQESV
MLTKLETALQQLLDSTEEAELFDPLPLSMVREHWLGQIDEHSLSQRFLAGAVNFATLMPM
RAIPFKRVCLLGMNDGEYPRSQPPLDFDLMGSDYRPGDRSRREDDRYLFLEALLSARQQL
YVSWVGRSQIDNNPMPPSVLVGQLRDHLEAGWHTQNGEALLEALTTEHPLQPFSRRYFSS
QASDSPAQARLFTYAHEWHALHAPRSENAQGSEPPSLQPDTEQQSTLTLAQLGGFLREPA
KAFFNNRLGVYFEQEELTQLDVEPFTLDGLQNWQLQDQLIAAQRHAVDNGQPRIEALHAA
LERFKGQGVLAVGAFGERMREALAEPMEALFGAYEEALQEWPQVVAAPQAVHVVETAAGK
VTLEDWLGELRQDDAGNRCRLLLLSSSLVSQGRGRGQYRWQHLLRPWVAHLAGNIERPMT
TQLLSKAGHVRLEPLDAENAHYQLQNMLNAWCDGMQAPLPLAPQAAFAWLAKLGTPDSET
DSDAYAAAETAYEGGRFQTGEVTQSAYLSHQWSSFERLFNERALGHSFVTLTEALYAPLH
RSVKG
NT seq 3618 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaaactctctgctcacgcaaacgccgctaacgccgggctttatggtggtgcat
gccaatcgcctggaagatttgcgcggtttggcggtggagtggatgcgccgacatccgctc
tcgccgctggagaacgagaccattctggtgcagagcaacggcatcgggcagtggctaaag
ctagcgctagcagaagacccggcccaaggcggtgcgggcatagccgcggcattgaacgtc
accctgcccgcgcgctttctatggcaggcctaccgaacggtgctaacgcagctaaccaat
gacgaccacgcggtgcctgaaacctcgccgttcgataagtcgcggttgatatggcgcctt
ctgcgcctgttgcccagccttgccgagcaggaagccttcgcgccgctagcacgcttttta
gaagtggatcgcgaccagcgcaagcactaccagctggccgagcgtctggcggatctgttc
gatcagtaccaggtgtatcgcgccgactggctggacgcctgggccaagggcaacgatgtg
ttgatcaccgcccgtggcgaagcccgcccgctggaagaacaccagctgtggcagccagag
ctgtggcgcgcactgcgcgatgatgtggctaataatcttggcgatgcaggccttaacagc
agccgcgcccaggtgcacagccgctttctggaagccgccgttcagcttgaaggccaagcg
tgcccacccggcctgccccggcgactgattattttcggcatctcatcgctgccgcaacag
acgttagaagccctggcggcgctgtcgcgctgctgccagatcgtgctctgcgtgcacaac
ccctgccagtactactgggcggatatcattgagcacaaagacctgctgcgcgccagccgc
taccgccagcagcgcaaggctggcatgcccgacgctttggacgtgctgggcaccggtgac
gccagcgatgccctgcacctacacgcccaaccgctgctggccgcctggggcaagcaaggc
cgcgactacctgcgcctgctcgacgaacacgacgacgcgggcaactaccaaaccctattt
gagcagcaggcgctacgaatcgatatgttcgagccctttagcggcgaagagcgcaactgc
ctactcagccaactccaagacgatatccgcgagctgcgcccggtagcagagacccaaacc
cactggcccgcgctagacccggtcagcgacgactccatcgtgtttcatattgcccacggc
ccccagcgggaagtggagatacttcacgatcagctgctggcggccttcagcgccgacccg
gatctgcgcccgcgggatatcatcgtcatggtgccggatatcgaccgctacgcgccccat
attgaagccgtattcggccagtaccgctccgccttcggtagctacaacgcgaacgctaga
cccgacgacccgcgctacatcccctacaccctttcggatcaagccagccgccaccgcctg
ccgatgatgatcgcgctggagaaattgttgcgcctgccggaattgcgcctttcggtgagc
gatctgctcgatttgctggaagtccccgccctgcgcacacgctttggcatcgatgaacac
gacctgcctacgctcagccgctggattgagggtgcaggtatccgctgggggctcaatgcc
gaacagcgcacccggctggatctacccgaagggctaacccagaacacctgggcctttggc
ctgcgccggttgctactggggtatacggtgggaagtgccgaggcgtggcaaggmatcgag
ccattcgatgatatcggcgggctggaagcctctttggcaggcccgctggcaaatctgctg
gaaaaactggaaagcacctggaaaaccttctgccagcccaccgacgccgccagctgggtg
gcccggctgcgtgaactgctggaaacctacttcctgaccgacgacgctcaagaaagcgtg
atgctcaccaagctcgaaaccgcactacagcagctgttggacagcaccgaagaagccgag
ctttttgatcccctgccgctctccatggtgcgcgaacactggctagggcaaatcgacgag
cacagcctttcccagcgcttcctggcgggagcggtcaacttcgccacgctaatgcccatg
cgcgccattccgtttaagcgtgtgtgtttattgggcatgaacgacggtgagtacccccgt
tcccagccgccgctggactttgacttgatgggcagcgactaccgccccggcgaccgctca
cggcgcgaagacgaccgctacctgtttctggaagcgctgctctccgcccgccagcagctt
tatgtcagttgggtcggccgcagtcagatcgacaacaaccccatgccgccctcggtgctg
gtcggccaactacgcgatcacctggaagcgggctggcacacgcaaaatggcgaggcgctg
ctggaagcgttaaccaccgagcacccgctgcagccttttagccgccgctacttctcttcc
caagccagcgactcccccgcccaggcgcggctgtttacctatgcacatgaatggcacgcc
ctgcacgcaccacgtagcgaaaacgcccaaggctccgagccaccgtcgcttcaaccggac
accgagcaacaaagcaccttaacattggcccagctaggcggctttctgcgcgaaccggcc
aaagcgtttttcaataaccgcctgggcgtctatttcgagcaggaagaactcactcaactg
gatgtagagcccttcaccctggacgggctacaaaactggcagttacaggatcagttaatc
gccgcccagcgccatgcagtggataacggccaaccaagaatagaagcgctgcatgcagca
ctagagcgcttcaaaggccagggcgtgctggcagtgggcgcctttggtgaacggatgcgt
gaagcgctggcggaaccgatggaggcgctgtttggcgcttacgaagaagcactgcaggag
tggccccaggtagtcgcagcgccccaggcggtgcatgttgttgaaacagctgccgggaag
gtaacgctggaagactggctgggagagcttcgccaggatgacgcgggcaaccgctgccgc
ttgctactgctcagcagtagcctggtcagccaagggcgtggccgtggtcagtaccgctgg
cagcacctgctgcgcccctgggtcgctcacttggcgggcaatattgaacgaccaatgacc
acccagctactctcaaaagcgggccatgtgcggctggagccgctagacgccgagaatgca
cactaccagctacaaaacatgctcaacgcctggtgcgatggcatgcaggccccgctaccg
ctggccccccaggccgctttcgcttggctggctaagcttggcacgcctgacagtgagacc
gatagcgacgcctacgccgccgccgaaaccgcctacgaaggcggccgattccaaaccggc
gaagtcacccaaagcgcctacctttctcaccaatggtcgagttttgagcgactgtttaac
gagcgcgccctagggcatagctttgtcacgctgaccgaggcgctctacgcgccgctgcac
cgttcggtaaaggggtga

DBGET integrated database retrieval system