KEGG   Halomonas sp. R57-5: HALO1927Help
Entry
HALO1927          CDS       T04029                                 

Definition
(GenBank) Beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ham  Halomonas sp. R57-5
Pathway
ham00071  Fatty acid degradation
ham00072  Synthesis and degradation of ketone bodies
ham00280  Valine, leucine and isoleucine degradation
ham00310  Lysine degradation
ham00362  Benzoate degradation
ham00380  Tryptophan metabolism
ham00620  Pyruvate metabolism
ham00630  Glyoxylate and dicarboxylate metabolism
ham00640  Propanoate metabolism
ham00650  Butanoate metabolism
ham00900  Terpenoid backbone biosynthesis
ham01100  Metabolic pathways
ham01110  Biosynthesis of secondary metabolites
ham01120  Microbial metabolism in diverse environments
ham01130  Biosynthesis of antibiotics
ham01200  Carbon metabolism
ham01212  Fatty acid metabolism
ham02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ham00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HALO1927
   00630 Glyoxylate and dicarboxylate metabolism
    HALO1927
   00640 Propanoate metabolism
    HALO1927
   00650 Butanoate metabolism
    HALO1927
  Lipid metabolism
   00071 Fatty acid degradation
    HALO1927
   00072 Synthesis and degradation of ketone bodies
    HALO1927
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HALO1927
   00310 Lysine degradation
    HALO1927
   00380 Tryptophan metabolism
    HALO1927
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HALO1927
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HALO1927
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HALO1927
Enzymes [BR:ham01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HALO1927
Exosome [BR:ham04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HALO1927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CEP35609
UniProt: A0A0D6E8J3
Position
I:2095204..2096391
Genome map
AA seq 395 aa AA seqDB search
MRLDDVVILGGARTAIGGFGGSLSTMAPFELGAITAKEALRRAGVEGGDIDHSVYGHIIT
TGPQDAYLARHIALEAGVPKEAGAFNVNRLCGSGVQAVVSAAQQIAMGDSRLALAGGAES
MSRGAYLLPPQVRNGVRMGDVNVEDLTLGILSDPFGSGHMGCTAENIAKQYGLSREQLDQ
FALESHQKAARAIAEGRFDDQIVAVEVSRGKQTVLFSRDEHVRDGVQLSDLARLKPAFQK
NGMVTAGNASGINDGAATLVLAHADEAAQRGLTPRAHLRVATSAGVEPTLMGLGPIPAVK
RCLQQAGLSINDIDVIESNEAFAAQAMAVAETLGFPLAKLNPNGGAVALGHPVGATGAIL
ILKALHELERINGRYGLITLCIGGGQGIALLIERG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcggttggatgatgtagtaattttaggcggtgcgcgtaccgcgatcggtggttttggc
ggttcgctgtcaacaatggcgccgtttgagctgggggcgatcaccgccaaagaggcgttg
cggcgggcaggcgttgagggtggcgatatcgaccactcggtatacggccacattattacc
accgggccccaggatgcctatctggcgcgccatattgcgctcgaagcaggtgtgccgaaa
gaggcgggggccttcaacgtcaatcggctgtgtggttcaggtgtacaggcggtggtctca
gccgcccagcagattgctatgggcgacagccgcttagcgctggcaggtggcgctgagtca
atgtcgcgcggggcttatctgctgcctcctcaagtgcgcaacggcgtgcgtatgggggat
gtgaatgttgaggatttaaccctaggcattttgagcgacccctttggcagcggccatatg
ggctgcaccgccgagaacatcgctaaacagtatggcctaagccgtgagcagttggatcag
tttgcccttgagagccatcaaaaagcggcgcgtgccatcgcggaaggccgctttgacgat
caaatcgtagcagtggaggtcagtcgcggtaagcaaacggtacttttctcccgcgatgaa
cacgtgcgcgatggcgtccaacttagcgatttggcgcggctcaagccagccttccaaaaa
aatggcatggtgaccgcaggcaatgcctcgggtatcaacgatggggccgccacgttagtg
ctggcccatgccgatgaagccgcacagcgtggcttaacgcccagggcgcatcttcgtgtt
gccaccagcgcaggcgttgagccaacgctaatgggccttgggccgattcctgcagtgaaa
cgttgcctgcagcaggcggggcttagtatcaacgatatcgatgtgattgaatccaatgag
gcctttgctgcccaagcgatggcggtggcggaaacgctcgggttcccgttagcgaagcta
aatcccaacggcggcgcggttgccttggggcatccggtgggggccaccggggctattctg
attctcaaagcgctacacgagttggagcgcattaatggccgctacggattgataacgcta
tgtattggtggagggcagggcatcgcccttcttatcgagcgcggctga

DBGET integrated database retrieval system