KEGG   Halomonas sp. R57-5: HALO2111Help
Entry
HALO2111          CDS       T04029                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ham  Halomonas sp. R57-5
Pathway
ham00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ham00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HALO2111
Enzymes [BR:ham01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     HALO2111
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     HALO2111
    1.1.1.-  
     HALO2111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 NAD_binding_3 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CEP35793
UniProt: A0A0D6E7S9
Position
I:2289734..2290798
Genome map
AA seq 354 aa AA seqDB search
MSQSSMQAAVWYAAKDLRVEQVSVPTISDPHEVKVKVAACGICGSDLHEYAAGPIFIPVG
KPHPISGEQAPIIMGHEFAGEVVEVGDKVTRVKVGDRVAIEPILSPNKDGAYQMERYNLT
PLLGFHGLSGGGGGFSEFTVMGEHMVHKLPDELSYEQGALVEPAAVALHAVRQSCLKAED
SAVVFGAGPIGLMTIEALKAAGAAQIYAVEVAPSRKAKAEALGATVVDPQQEDPVAKLQA
LSGGGVDVAFEVTGIPAVLNQALNSTHEGGEVVVVSIWEGEASFQPNDLVIKERTMKGII
AYRHVYPAVMALMQRGYFRAEDMVTQRIPLADIVEEGFEALLSDKAQVKIIVTP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatcaagcatgcaggcagctgtgtggtacgcggcaaaagatcttcgcgttgag
caagtttcggttcccactatcagcgacccccatgaagtgaaggtgaaagtcgccgcctgt
ggcatttgcggcagtgatctgcacgagtatgctgccgggccgatttttattccggtaggt
aagccgcacccgatcagtggcgagcaggcgccgatcattatgggccatgaatttgccggg
gaagtggtcgaggtcggcgataaggtaacgcgagtaaaagtgggcgaccgcgtcgccatt
gaaccgattctctcgcccaataaagacggcgcctaccaaatggagcgctataacctgacg
cccttgcttggctttcatggcctctcgggcggtggtggtggcttctcggagttcaccgtg
atgggtgagcacatggtacataagctgccggatgagcttagctacgagcagggcgctctg
gtagagcccgcggcggtagcgctgcatgcggtgcgccaaagctgcctgaaagccgaggat
agcgcggtagtatttggcgctggaccaatcggtttgatgactattgaggctcttaaggcc
gcaggagctgcgcagatttatgcagtggaagtggcaccatctcgtaaggccaaagctgaa
gcgctaggggccactgtggttgatccgcaacaggaggatccagtggcgaaattacaagcc
ttgagcggtggcggggtagacgtggcgtttgaggtgaccggaattcctgccgtgctcaat
caggcgctgaatagcacccacgaagggggtgaagtggtggtggtgagtatttgggaagga
gaggccagctttcagcctaacgacctcgtcatcaaagagcgtaccatgaagggcattatc
gcctatcgccatgtttacccagcggtgatggcgttgatgcagcggggctacttccgcgcc
gaggatatggtcacccagcgcattccactggcggatatcgtggaggagggctttgaggcg
ctgctaagcgacaaagcccaggtgaaaattatcgtgacaccctag

DBGET integrated database retrieval system