KEGG   Halomonas sp. R57-5: HALO2748Help
Entry
HALO2748          CDS       T04029                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ham  Halomonas sp. R57-5
Pathway
ham00970  Aminoacyl-tRNA biosynthesis
ham01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ham00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HALO2748
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ham03029]
    HALO2748
Enzymes [BR:ham01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     HALO2748
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     HALO2748
Mitochondrial biogenesis [BR:ham03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HALO2748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CEP36430
UniProt: A0A0D6EA28
Position
I:2962851..2964266
Genome map
AA seq 471 aa AA seqDB search
MSDTDLGSLDAQTLAHLFESREASPLEVTRAALDRIERFNPDVNAYVYVDAEGAESAAKA
SARRWGQGKPLSPIDGVPVSLKDLTQVAGMPCREGSLTSSEALCDTDAPPARMLREAGAI
LLGKTNTPEFGWKAVTDNRVFGATANPWDTRLTPGGSSGGAXAAAALNMGVLHQGGDSGG
SIRIPAAFTGVFGFKPTFGWTPQWPPAKEPSLSHLGPLTRTVRDAVSMLNVMGRYDYRDP
YATRGQPEDWGVDLDKGLTGLRIGYSTDLGYAKVDPQIAERVREAANRLEALGAEVVDVH
PGFSSPLDTFRKLWFTASLEQWSQMDDHQRTLLDSGMIANARKAEPWKAVELFRALADRA
ELTQRLEHFNQEYHLLMTPSVAIQPFEINQEVPPGSDMRDWEEWAPFSYPFNLSQQPAAS
VPCGFTDNGLPVGFQLAGGKYDDVRVLRACHAYMEAHPPRFPSVPNPAQYA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataccgatctcggcagtttagatgcccagaccctagctcacttgtttgaaagc
cgcgaggcctccccgctagaagtcacccgcgccgctcttgatcgaatcgagcgcttcaac
ccagacgttaacgcctatgtgtatgtcgatgctgaaggtgcggaatcggcggccaaagcc
tcggcgcggcgctgggggcaaggcaagccgctaagccccatcgacggggtgccggtatcg
cttaaagacctgacccaggtggcgggcatgccctgccgagaaggatcgttaacctcttct
gaagcgctatgcgacaccgatgcgccacccgcgcgcatgctgcgtgaagcgggcgccatc
ctgctaggcaaaaccaacacgcccgaatttggctggaaagcagtaacggataaccgtgtt
tttggcgccacggccaacccctgggatacgcgtttaacccccggaggctcttccggcggg
gccgscgcggccgcggcgctcaatatgggggtgctgcaccagggcggcgactcaggcggt
tctatccggattcccgctgcattcaccggggtttttggctttaagcctacctttggctgg
acgccccaatggccgccagctaaagagcccagcctatcgcacctggggccattaacgcgc
accgttcgagatgcggtgagtatgttaaacgtgatgggccgctatgattaccgggaccct
tacgccacccgcggacagcctgaagactggggtgtcgatttagataaaggcttaaccggg
ctgaggattggctactcaactgatcttggctacgcgaaggtagacccgcaaattgccgaa
cgcgtgcgcgaagcggccaatcggttggaggcattaggcgctgaagtggtcgacgtgcat
cccggcttttcctcaccgctggatacctttcgcaagctatggtttaccgcctctttagaa
cagtggtcacaaatggatgaccaccagcgtacgctgctagattcaggcatgatagccaat
gcccgtaaagccgaaccctggaaagccgttgaactgtttcgtgccttggcagatcgcgcg
gaattaacccagcgccttgagcactttaaccaagagtaccatctgctgatgacgccctcg
gtggcgatacagccgtttgaaataaaccaagaagttccgccaggcagcgatatgcgcgac
tgggaagagtgggcgccctttagctatccctttaacctgagccagcaacccgccgcgtca
gtgccctgtggctttaccgacaacggtttaccggtgggcttccagctcgcgggcggcaaa
tatgatgatgtgcgcgttttgcgtgcctgccatgcctacatggaagcgcaccccccgcgt
tttcctagcgttcccaaccctgcccagtacgcttaa

DBGET integrated database retrieval system