KEGG   Halomonas sp. R57-5: HALO2783Help
Entry
HALO2783          CDS       T04029                                 

Definition
(GenBank) Tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
ham  Halomonas sp. R57-5
Pathway
ham00380  Tryptophan metabolism
ham01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ham00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    HALO2783
Enzymes [BR:ham01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     HALO2783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase Hs1pro-1_C
Motif
Other DBs
NCBI-ProteinID: CEP36465
UniProt: A0A0D6EA56
Position
I:2999003..2999839
Genome map
AA seq 278 aa AA seqDB search
MTTPEENSVDNEAIHWDQDISYGQYLDLEPLLACQNPASDEHDELLFIVIHQVSELWIKL
CLHEAHGAAAHIQEDNLRPAFKMLARVSRIQEQLIKAWEVLVTMTPADYASFRDSLGQSS
GFQSYQYREMEFLLGNKNAKLIEAHRSKPKHYQKLQESLHAPSLYDIVLQLLAKRGFSIP
ESKTQRDWSIPYTASSEVEAVWTEIYRNSEQHWDLYELAEKLVDVEFNFQRWRFSHMKTV
ERIIGYRRGTGGTAGVNYLVKALDLQFFPELWSVRTTI
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcctgaagaaaacagcgtcgataatgaagccattcattgggatcaggatatt
agctacggtcagtacctggatctggaacccttgcttgcttgccaaaatccggcttctgat
gaacacgatgaattactctttatcgttatccatcaagtatcggagctatggatcaaactg
tgccttcacgaagctcatggtgccgcagcgcatattcaagaagataacctgcgccctgct
ttcaagatgctagcgcgggtttccagaattcaagaacagcttatcaaggcctgggaagtg
ttggtcaccatgacccccgccgactatgccagcttccgagacagccttggccaaagctct
gggtttcagtcctatcaatatcgggaaatggaattcctgttgggtaacaagaacgccaag
ctaatcgaagctcaccgatcaaaacccaaacactaccaaaaacttcaggaatccctccac
gcgcccagtctttacgatatcgtactgcagctgcttgccaaacgcggtttcagcattccg
gaaagcaaaacccaacgcgattggagtatcccctacaccgccagtagcgaggtggaagcg
gtctggacggaaatctaccgcaacagcgaacagcactgggatctatacgagctcgctgaa
aaactggtggatgtcgaattcaactttcagcgctggcgattcagccacatgaaaacagtc
gaacgtatcattggttatagacgcggcacagggggaacggctggggtgaattatctggtc
aaagcgctggatcttcaattcttcccggaactgtggagtgttcggacgacgatataa

DBGET integrated database retrieval system