KEGG   Halomonas sp. R57-5: HALO3653Help
Entry
HALO3653          CDS       T04029                                 

Definition
(GenBank) Pyridoxal phosphate-dependent transferase, major domain
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ham  Halomonas sp. R57-5
Pathway
ham00260  Glycine, serine and threonine metabolism
ham01100  Metabolic pathways
ham01110  Biosynthesis of secondary metabolites
ham01120  Microbial metabolism in diverse environments
ham01130  Biosynthesis of antibiotics
ham01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ham00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HALO3653
Enzymes [BR:ham01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     HALO3653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CEP37335
UniProt: A0A0D6ECK3
Position
I:3969439..3970446
Genome map
AA seq 335 aa AA seqDB search
MIDLRSDTVTRPTSAMKDTMMAAPVGDDVWGDDPTVNAFQANLAEQAGKEAALLFPSGTQ
SNLVALMAHCERGDEYIVGQSAHAYRWEGGGAAVLGSIQPQPIENAADGSLPLEKISAAI
KADDFHFARTKLLALENTFGGKVLPAEYVLKATELARERGLATHLDGARLFNAAVATDTS
LKQLCLPFDSVSLCFSKGLGTPIGSALVGSQALIDRARRWRKVVGGGMRQSGIIAAACQY
ALDHHVADLADDHRRAARLAEGLAKLPGVKITAQATNMVFVHFPDAHVKPLSAWLKEHGI
LIELLYATRFVTHRDLNDADIDKVIAVMEAYFSRH
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgatacggtgacccgtccgacctctgccatgaaagacaccatg
atggccgccccggttggcgatgatgtgtggggcgatgacccaacggtcaacgcgtttcaa
gccaacctggccgagcaggcaggtaaagaagcggcgctgctgtttcctagcgggactcaa
agcaacctggtggcgctaatggcccactgcgagcgcggcgatgagtacattgttgggcag
tccgcacacgcctatcgttgggaaggcggtggcgccgcggtgctgggcagtatccagccc
cagcccattgaaaacgccgccgacggtagcctgccactggaaaaaatcagtgccgcgatt
aaagccgacgattttcactttgcgcgtactaagctgctggcattagaaaacacctttggc
ggcaaagtgctgcccgcagagtacgtattaaaagccactgagcttgcccgcgagcgtggt
ttggcaacgcacttagacggcgcgcgactgtttaatgcagcggtcgccacggatacctcg
ctcaagcagctctgcctaccgttcgatagcgtatcgctgtgcttctcaaaaggcctgggt
acgccaatagggtcggcactggtgggctcacaagcattgatcgaccgcgctcggcgctgg
cgtaaagtggtgggtggcggtatgcgccaatcagggattatcgccgccgcctgccagtat
gcgttagatcatcacgtagccgacttagccgacgatcaccgccgcgctgctcgcctggca
gagggcttagcaaagctgccaggggtcaagattaccgcccaggcaaccaatatggtgttc
gtgcatttccccgatgcgcatgtaaagccactctccgcctggctaaaagagcacggcatt
ttgattgagctgctttacgccacgcgcttcgtgacccatcgcgatcttaatgatgcggat
atcgacaaagtcatcgcggtgatggaggcttattttagtcggcattaa

DBGET integrated database retrieval system