KEGG   Halomonas sp. R57-5: HALO4000Help
Entry
HALO4000          CDS       T04029                                 

Definition
(GenBank) Pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
ham  Halomonas sp. R57-5
Brite
KEGG Orthology (KO) [BR:ham00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ham03016]
    HALO4000
Enzymes [BR:ham01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     HALO4000
Transfer RNA biogenesis [BR:ham03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    HALO4000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: CEP37682
UniProt: A0A0D6EDV7
Position
I:complement(4376058..4376831)
Genome map
AA seq 257 aa AA seqDB search
MTPLNLLYQDEHLVAVHKPSGLLVHRSALARGETEFLLQRLRDQIGKRVYPVHRLDRPTS
GVMVFALSSTVAGLLSDAFSERQVEKRYLAVVRGKAPESERLDYPLREEDGTRPKAEMPA
MPAMTDIRRLDSVELPVQVDRYPVARYSLVEARPLTGRRHQIRRHLSRRGYPIIGDAKHG
KSVHNRFFAEQLGAPRLLLAATYLAFNHPLLDKRVQLSCALDDTMVALFNHLGWAGHLPL
DSLRTPPHAKPSALQVL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacgccactcaacctcctttaccaggatgagcacctcgtcgcggtgcacaagccgtca
gggcttttggtgcatcgctcggcgttggcgcgtggcgaaaccgagtttctacttcagcgc
ctgcgcgaccagatcggcaagcgggtctatcctgttcatcggctggatcgacccacatcc
ggcgtgatggtgtttgccctctcttcaacagtagcaggcctactcagcgacgcctttagc
gagcgtcaggtggagaagcgctacttggcggtggtacgcggtaaagcgccggagagtgag
cgtttggactacccgctgcgggaagaggatggcacgcgacccaaggcggaaatgcccgct
atgccagcgatgacggatattcgccgtctggatagcgtcgagcttccagtgcaggtcgac
cgctacccggtggcgcgttattcgctggtcgaagcgcgcccactgaccggacggcgccat
caaattcgtcgccatctttcacggcggggttatccgattattggcgatgccaagcacggt
aaaagtgtccacaaccgcttttttgccgaacagctgggggcgccacgattattgctggcg
gccacctatttggcctttaaccatccgctgctcgacaagcgggtacaattaagctgtgcc
ttggatgacaccatggtcgcgctgtttaatcaccttggctgggcggggcatctaccgctg
gatagtctgcgcacgccaccccacgccaagccttcagcccttcaagtgctatga

DBGET integrated database retrieval system