KEGG   Helianthus annuus (common sunflower): 110864809Help
Entry
110864809         CDS       T05101                                 

Definition
(RefSeq) methylenetetrahydrofolate reductase 1-like
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00670  One carbon pool by folate
han01100  Metabolic pathways
han01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    110864809
Enzymes [BR:han01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     110864809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 110864809
NCBI-ProteinID: XP_021969652
AA seq 597 aa AA seqDB search
MKVIDKILESTTAGDAGKVVFSFEFFPPKTEEGVENLFERMERMVAHNPTFCDITWGAGG
STAELTLEIARRMQNLVCVETMMHLTCTNMPVEKIDHALESIKKDGIQNVLALRGDPPRG
QDKFVQIQGGFACALDLVEHIRRSYGDYFGIAVAGYPEAHPEVIESNGLATPEAYAKDLA
YLKRKVDAGADVIVTQLFYDVDNFLKFVNDCRQIGITCPIVPGIMPINNYNGFIRMTGFC
KTKIPSEITAALEPIKDNEEAVRAYGVHLGTEMCKKIMASGIKTLHLYTLNMEKSALAIL
TNLGLIEESKVSRPLPWKKPTNLFRLKEDVRPIFWANRPKSYITRTTGWEQYPRGRWGDA
SNASYGALTDHQFMRPRSRDKKIQEEWVVPLKKFDDISEKFTKYCLGQLKTSPWSELDAL
QPETKIIDEQLASINQKGFLTINSQPPVNGAKSDSPSVGWGPAGGYVYQKAYVEFFCSGE
KLNSLVEKSKAYPSLTYLAVNKEGNLVSNVGKTDVNAVTWGVFPAKEIIQPTVVDPASFL
VWKDEAFEIWSRGWAQLYPEDDSSRSLLQEVQNTYYLVSLVDNDYINGDLFNVFKDF
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatcgacaagattctggagtccactactgccggagacgccggaaaagtagtc
ttctcgttcgaattctttcctccgaaaaccgaagaaggcgtggaaaacctgttcgagcgg
atggagcgaatggtggcgcacaatcctacattctgcgacatcacttggggagccggtggc
tctacggcggagctgacgctggagatagcgaggaggatgcagaatttggtgtgtgtggag
acgatgatgcatttgacgtgtacgaatatgccggtggagaagatagatcacgcgttggag
agtattaagaaggatgggatacagaatgttttggctctgagaggtgatccgccacgtgga
caggataagtttgttcagatccagggaggttttgcgtgtgctcttgatctggtggagcat
atccgcaggtcatatggtgactattttggcatagccgttgctggttatccagaggcacat
cctgaggtcattgaaagcaatggcttggctacacctgaagcatatgcaaaggatcttgct
tacctcaagagaaaggttgatgcaggagctgatgtgattgtcactcaacttttctacgac
gttgacaattttctcaaatttgtgaatgattgtcggcaaattggaattacttgtcccatt
gttcccggcatcatgcccattaacaactataacggcttcattcgcatgactggtttctgc
aaaactaagatcccgtccgaaatcactgctgctttggagcccattaaggacaacgaggaa
gccgttagagcttatggagttcacctcggaaccgaaatgtgcaagaaaattatggctagt
ggaatcaagacattgcatctttatacactcaacatggagaagtctgcattggcaattttg
accaatcttggattgattgaagagtccaaggtatcaaggccactgccatggaaaaagcct
actaaccttttccgtctaaaggaagatgttaggccaatattctgggccaatcgtccaaag
agctacataacaagaactactggatgggagcagtatccacgtgggcgctggggcgatgct
tctaatgcttcatatggtgcattaaccgatcatcagttcatgcgaccacgttcacgtgac
aagaaaattcaagaagaatgggtggttcctttgaaaaagtttgatgatatttctgagaaa
ttcacgaaatactgccttgggcaactgaaaaccagcccttggtctgaactagacgcgctt
cagccagagacaaagattattgatgaacaactagcttcaattaaccaaaagggtttcctc
accatcaacagccaaccgcccgttaatggagctaaatccgactccccatcagttggatgg
ggcccagcgggtgggtacgtttaccagaaagcatatgtagaatttttctgctccggtgaa
aagttaaacagtcttgtggagaaatcaaaggcgtacccttcacttacatacctagcggtg
aacaaagaagggaatttggtgtcaaatgtggggaaaactgacgtgaatgcagtaacttgg
ggagtgttcccagctaaagagatcattcaaccaactgtcgttgatcccgctagctttttg
gtatggaaggatgaagcgtttgaaatctggtcaagaggatgggcgcaattgtaccccgag
gatgattcatcaagatcacttctccaagaggtacagaacacttactacttggttagcttg
gttgataacgactacataaacggcgacttgttcaacgttttcaaggatttttaa

DBGET integrated database retrieval system