KEGG   Helianthus annuus (common sunflower): 110865303Help
Entry
110865303         CDS       T05101                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 2 isoform X1
Organism
han  Helianthus annuus (common sunflower)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Stress-antifung Haspin_kinase APH Pkinase_fungal ABC1 Kinase-like
Motif
Other DBs
NCBI-GeneID: 110865303
NCBI-ProteinID: XP_021970239
AA seq 618 aa AA seqDB search
MWMSTIVVVVIVLVVTGLGVAQPSTQTTNTPLKYYCGSYYPMSTTVFFTNRNSTYSQLRS
QLSKTGVYYARAEDMVNGDAVYGVAQCRNYLASSECLACFDVAVSALEPCGSANGAHVFL
DNCYLRFENYDQFYNDPQGDLDVDVTEICGNESTSQPVKSFNQVVKELLSDISVATPRTP
DVYIASTRQLTSGVNATVYAIAQCVENASQAICKNCLSQAYNKLYSCVPASEGRAINVEC
FMRYSEFPFFQNNQTINLVPFLGTGHSSKSRTIIGVSSSVGLIFLILALFLSFRRWIKSK
AVGKGTRCYSYQDLKLATNNFSDEYLIGRGGFAQVFKATIEGGIAVAVKKINVGSRAKKD
FENEVNLISNVRHRNLILQLGWCIHGTRLLLVLEYMPHGSLDKFLWGEKKGTLNWKQRCD
IILGIARGLVHLHSESHVKIVHRDIKSSNILLDDDFQPKIADFGLARLYLEDQTHVSTRF
AGTMGYTSPEYATRGHLSEKVDTYSFGIVALEVISGQSCSDVKYSGPRMEYLLEHAWQLY
EKGIHNKLVDEAIDPNEYLEENVMNIIEIALMCTQLAALRPTMSEVYLMLSSEPKLEQRQ
MSNPTFIDAHRRIYKVGS
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgtggatgtcaactatagtggtggttgtgatcgtattggtggtaacggggctcggtgtt
gcacagccgagcacccaaaccaccaatacgccccttaaatattactgtggcagttactat
ccgatgtccacaacagtttttttcacgaaccgtaactctacatattctcaactcagaagt
cagttgtcgaagacaggtgtatattatgcccgagccgaggacatggtgaacggggatgca
gtatatggagttgcccagtgccggaattacctcgcatcgagtgagtgtttggcttgcttt
gatgtggctgtatccgcccttgaaccctgtggttctgccaatggcgcccatgtatttctg
gataactgctacctcagatttgagaactacgatcagttctacaatgatccgcaaggtgat
ttggatgttgatgtcactgaaatatgtggtaatgagtcaacatctcagccagtaaaatcc
ttcaaccaagtagtgaaagaactattatcagatatcagtgttgctaccccaagaactccc
gatgtctacattgcatcaacaaggcaattgactagtggcgtaaatgcaacagtctatgcg
attgcgcagtgtgttgagaatgcaagccaggccatttgcaagaactgcttgagtcaagca
tataacaagttgtacagttgtgtgcctgctagtgaaggaagagccatcaatgtggaatgt
tttatgaggtattctgagtttccattttttcagaataaccagacaatcaatctcgtacct
ttcctaggtacagggcattcaagtaaatctcgaacaatcataggagtaagcagcagtgta
ggtcttatcttccttatccttgctttattcttgtcgttccgtcgatggataaagtccaag
gctgttggaaaaggcacacgatgttacagttaccaagatttgaaactagcaacaaataat
tttagtgacgagtatctaataggaagaggaggttttgcccaagtgttcaaggccactata
gaaggcgggattgcagtggcagtcaagaaaatcaatgttgggtctagggcgaaaaaggat
tttgaaaatgaggttaatcttatcagtaatgttcgccaccgcaatcttatcctacaattg
ggatggtgtattcatgggactaggctacttcttgtgctagaatacatgccccatggaagc
ctagacaagtttttgtggggtgaaaaaaagggaactttgaattggaaacaaaggtgtgac
attatcttggggattgcaaggggacttgtccatctacatagcgaatctcatgtcaaaatc
gttcacagagatataaagtcaagcaacattcttcttgacgatgatttccaaccaaaaatt
gcggatttcgggttggctaggctctatcttgaggaccaaacacatgttagtacccggttt
gctgggactatgggctacacatcaccagaatatgcaactcgtggacacttatctgaaaaa
gtagacacttacagctttggtatcgtagcccttgaagtcattagtggtcagagttgtagt
gatgtgaagtacagtggaccgcgaatggagtatctcctcgaacatgcatggcaattgtac
gagaaaggcatacataacaagttggttgatgaagctatagatccaaatgaatatctagaa
gaaaatgtgatgaatattatagagattgctctaatgtgcactcagttagctgctttaagg
ccaaccatgtctgaagtttacttaatgttgtccagtgagccaaaattggagcaaagacag
atgtccaaccctaccttcattgatgctcatagaagaatttacaaagttggaagttga

DBGET integrated database retrieval system