KEGG   Helianthus annuus (common sunflower): 110867889Help
Entry
110867889         CDS       T05101                                 

Definition
(RefSeq) probable glutathione peroxidase 8
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00480  Glutathione metabolism
han00590  Arachidonic acid metabolism
han01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110867889
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110867889
Enzymes [BR:han01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     110867889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 110867889
NCBI-ProteinID: XP_021972637
AA seq 164 aa AA seqDB search
MANQPESIYDLTVKDANGVNVDLSIYKGKVLLVVNVASKCGLTNSNYSELNQLYAKYKAQ
GLEILAFPCNQFGDEEPGSNKQILEFVCTRFKSEFPVFDKIEVNGENAAPIYKFLKSGKR
GIFGDDIQWNFAKFLVGRDGQAVGRYYPTTSPLTIERDVQKLVE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaccaacctgaatccatctatgatcttacagtcaaggatgctaatggagtcaat
gttgaccttagcatctacaaaggaaaagttttacttgtagtcaatgttgcctccaaatgc
gggttgacgaattcgaattactccgagttgaatcaactctatgcaaaatacaaagctcaa
ggtttggaaatcttggcatttccgtgtaatcaatttggggatgaggagcccgggagtaac
aagcagattttagagtttgtttgtactcgattcaaatccgaattccctgttttcgacaag
attgaagtgaatggcgaaaacgctgcaccaatatacaagttcttgaagtcgggaaaaaga
ggtatcttcggggacgacattcaatggaactttgcaaaatttttggttggtagagacggg
caggctgttggacgttattacccgacaacttcacctctcacaatcgagagagatgtgcag
aaacttgtggaatag

DBGET integrated database retrieval system