KEGG   Helianthus annuus (common sunflower): 110868064Help
Entry
110868064         CDS       T05101                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK4
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:han01001]
    110868064
   01009 Protein phosphatases and associated proteins [BR:han01009]
    110868064
Enzymes [BR:han01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110868064
Protein kinases [BR:han01001]
 Serine/threonine kinases: Other
  Wnk family
   110868064
Protein phosphatases and associated proteins [BR:han01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110868064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 110868064
NCBI-ProteinID: XP_021972843
AA seq 455 aa AA seqDB search
MASEEDPDVVERCPKNRYVRYNELLGRGAWKTVYKGFDEVEGIEVAWSQVMLDEAIQKPE
NLERVYSEVHLLKTLKHENIIKSYVSWVDDEKKTVNMITELFTSGNLRQYRKKHKSVDLK
AIKNWARQILKGLVYLHGHEPPIIHRDLKCDNIFVNGNHGKVKIGDLGLATIMLRPTAKS
LIGTPEFMAPELYEEEYNELVDIYSFGMCILELITCEYPYSECRNPAHIYKKVISGIKPA
ALSKVKDPQVKEFIEKCLVPASQRLPAKELLKDPFLAPESTKEHVHNPVEVNLSTYPMDI
DDNFDMVSSTSNTTSTGLPLLELQSINARNEIRLKGEMNEENTVKLTLRIADFSGSARNI
DFPFSLDADTAHTIAQEMVEELDLLHEDVIIIAELIDDMIMKFVPTWKPSFKKNSISGGG
VSSTEGSIVQNNQIAYGPTKEDHSFKGFDVVYIFG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgaagaggatcctgatgttgttgaaagatgcccgaaaaatcgctacgttcgg
tataatgaattgctggggaggggtgcctggaagacagtatacaaggggtttgatgaagtt
gaaggaattgaagttgcatggagccaagtgatgttagatgaggctattcaaaaacctgaa
aatctggagcgagtttattccgaggttcacttgctaaagacgcttaaacatgagaacata
atcaagtcatatgtttcttgggtagacgacgagaagaaaacggttaacatgattactgaa
ctgtttacctcggggaatttgaggcaatatcgcaagaagcataagagtgttgatttaaag
gctatcaagaattgggccagacagatccttaaaggcttggtttatctgcacggtcatgag
ccgccgattattcatcgagatttaaaatgtgacaacatatttgttaacggaaaccatgga
aaagtgaagatcggcgatcttggattagcaacgataatgctacgccccactgctaaaagt
ttgattggaacccctgaattcatggctccggagctttacgaagaggaatataatgaactt
gttgacatatattctttcgggatgtgtatattagagttgataacttgtgaatatccgtac
agtgaatgcagaaatcccgcacacatatataaaaaagttatttctgggataaaacccgct
gctctttcaaaagtcaaagatccacaagtcaaggagttcatagagaagtgtttggtcccg
gcatctcaaagattgcccgcaaaagagcttctgaaagatccatttctcgcaccagaaagt
acaaaagagcatgtacacaatccggttgaagtcaacttgtcaacatatccgatggacatt
gacgataacttcgatatggtttcatctactagcaacactaccagcactggtttacctttg
cttgaacttcagtctatcaatgcgagaaatgaaatccgattaaaaggcgaaatgaatgaa
gaaaacactgtcaagttaaccttgagaatagccgattttagtggtagtgcgaggaatatt
gacttcccgttttcgctcgatgctgatactgcacatacgatagctcaagaaatggttgaa
gaactagaccttttgcacgaagatgtgattattatagcagagctgatcgatgacatgatt
atgaagttcgtgccaacatggaaaccatcgttcaagaaaaattccatatctggtggagga
gttagctcaaccgaaggttcaatagttcaaaacaaccaaatcgcatacgggcccacaaag
gaagatcacagtttcaaagggtttgacgttgtttacatattcgggtga

DBGET integrated database retrieval system