KEGG   Helianthus annuus (common sunflower): 110872407Help
Entry
110872407         CDS       T05101                                 

Definition
(RefSeq) phosphatidylinositol-3-phosphatase myotubularin-1-like isoform X1
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00562  Inositol phosphate metabolism
han01100  Metabolic pathways
han04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110872407
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    110872407
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:han01009]
    110872407
Enzymes [BR:han01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     110872407
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     110872407
Protein phosphatases and associated proteins [BR:han01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    110872407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM 3-PAP SYCE1 Y_phosphatase Y_phosphatase3 bPH_3 DUF5082 FliT
Motif
Other DBs
NCBI-GeneID: 110872407
NCBI-ProteinID: XP_021976890
AA seq 855 aa AA seqDB search
MAMPRNRRTTTSLRDSDTTRLPDSDKIEGAGSWDALEWTKIDQPVVSRPVPHGLSDFLYE
AEEVLAEGYGVLANTDEAGTLFVTNFRLLFLSEGSRDIIKLGTIPLATIERFNKIVIKQQ
SGPRQSDKTPTRRLLQVIGKDMRIIIFAFRPRTKQRRAVFEALLRCARPSRLWDLYAFSS
GPSRFSNISPRVRLVNEYLRLLGVESRHSSLSTIEDGSFTSSNNWWRISDVNATYDMCPT
YPFSLLLPKSIRDEDVLQACKFRARSRLPVISWCDGRTGAVLARSSQPLVGLMMNMRSNA
DENLVGALCTELPGGKRGRRKLYIADARPRKNALANGAMGGGSESSANYFQSEIVFFGID
NIHAMRESLVRLRDYLDTHGTKSSDGMSSFLRHGGWTWGGGNLSSMSASVSTLGDSGWLI
HIQNVLAGSAWIAARVAIESASVLVHCSDGWDRTSQLVALASLLLDPYYRTIKGFQALVE
KDWLAFGHPFLDRAGMASLMGSGLELPRQSSSANFPSSPMRQTPGTFPSQSPMSNQTQTS
NHYSPIFLQWVDCVSQLLRMYPFAFEFSSAYLVDFLDCTLSCRFGNFLCNSEKEREQYGV
SDACGCLWMYLDDMRAKVGSSHVHYNLFYDPSKHEGPLLPPAAALAPTLWPQFHLRWSCP
SEAQTGEVEAQCRSLVEKISELQRAKDAAESKAREMIATMEAVKAEIRNEKQISSSAMNL
ARKAKRENGIIKRAIQSLGCTIHVSENDDCTINIERNLIDLPERITSSRSTNSPHSYDEK
MDMSVSVTLTPDDDDVSENPILRVCENLCPQRTRDGGCKWPDSSCAQLESQFVGLRANYD
AFDRLSIYDSYFQPE
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgcccagaaaccgacgcacaacaacttctctccgcgactccgacaccactcga
ctccctgactccgataagattgaaggcgccggtagttgggacgctcttgagtggaccaag
atcgatcagcctgttgtttcaaggcctgttcctcatggattgtctgattttttgtatgaa
gctgaggaggttctcgctgaggggtacggtgttcttgccaataccgacgaagcaggtacc
ttgttcgtgaccaatttccgtcttctttttttgagtgaaggatccagggatattatcaaa
ctgggaactataccattggccaccattgaaagattcaacaagattgtaataaagcagcag
tcaggacctaggcaatctgataagactcctacacgacgtcttcttcaagttattggaaaa
gatatgaggattattatatttgcttttcgtcctcgaactaaacagagacgtgctgtattt
gaagcattactgaggtgtgcaaggccctcaaggctctgggatctgtacgccttttcttcc
ggcccatcaagatttagcaatattagccctagagtgcgattagtaaacgaatacttacgg
cttcttggtgtggaatcacgtcattcatcattaagcaccattgaagatggttccttcaca
tcgtctaataattggtggaggattagtgacgttaatgcaacttacgatatgtgtccaaca
taccctttttctctgttattaccaaaatcaattagagacgaggatgtgctgcaagcttgt
aaatttcgtgcacggagtagattgcctgtaatatcatggtgtgatggacgcactggagct
gttcttgcacgatcctcccagccattggttggtctgatgatgaatatgagaagtaatgct
gacgagaatctggttggtgctctctgtactgaacttcctggtggaaagagaggacgcagg
aaattatatatcgctgatgcaagaccgagaaaaaatgctttagcaaacggggcaatggga
ggtggttcagagtcatccgccaattatttccagtctgagattgttttcttcgggatagat
aatattcatgccatgcgggagagtcttgttcgtctcagagactatttggatacacacgga
actaaatcatcagacgggatgtcatcattcttgagacatggtggatggacttggggtgga
ggtaatctcagcagtatgtctgcatctgtatcaacccttggtgacagtggctggttaata
cacatccaaaatgtgctggcgggctccgcttggatcgctgctcgtgttgcaattgagtca
gcatccgtgcttgttcactgcagtgatggatgggatagaacaagccagctagttgctctt
gcaagtttgttactcgatccatattatcgcaccatcaagggatttcaggcactcgtggaa
aaagattggcttgcatttggacatccctttttagaccgagctggaatggcaagcctaatg
gggagcggtttagaattaccgaggcagtcttcaagcgcgaatttcccgtcatcgccaatg
cgccagacacctggcacattcccgtctcaatctccaatgtctaatcagacgcaaacttca
aaccattattctccaatatttcttcagtgggttgattgtgtctctcagttattgcgaatg
tacccttttgcattcgagttctcatcggcttatttggttgactttctggattgcacactt
tcttgtcgttttgggaacttcttgtgcaatagtgagaaggaaagagaacaatatggtgtg
tcagacgcgtgtggatgcttgtggatgtatttagatgatatgcgtgctaaagtggggagt
tctcatgtgcattacaacctcttctacgatccatctaaacacgagggtccgttattgccg
ccagctgccgctttagccccgacgttgtggccgcagtttcatctgaggtggtcatgtcct
tcagaagctcaaaccggagaggttgaagctcagtgtaggagtctggtcgagaaaatctcc
gaacttcaaagggcaaaggatgctgccgagagtaaagcccgagaaatgattgccacaatg
gaagccgtaaaagccgagatacgcaacgagaagcagatcagcagctcagccatgaatctg
gcaagaaaagccaaaagggaaaacggtatcataaaacgagcaatacaatctcttgggtgt
acaatacacgtgtcggaaaatgatgactgtacaatcaacattgaaaggaatctaatcgac
cttcccgaaagaataacttcgtcccgttcaaccaacagtccacactcgtatgatgaaaag
atggacatgtctgtatccgttaccttaacccctgatgacgatgacgtttccgagaaccca
attcttagagtttgtgaaaacctgtgcccgcaacggacccgagatggcgggtgtaagtgg
cctgattctagttgtgctcaactcgagagccagtttgtcggtttgagagctaactatgat
gcttttgatcggttatctatttatgatagctactttcaacccgaatga

DBGET integrated database retrieval system