KEGG   Helianthus annuus (common sunflower): 110872695Help
Entry
110872695         CDS       T05101                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00010  Glycolysis / Gluconeogenesis
han00562  Inositol phosphate metabolism
han01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110872695
   00562 Inositol phosphate metabolism
    110872695
Enzymes [BR:han01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110872695
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110872695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 110872695
NCBI-ProteinID: XP_021977246
AA seq 495 aa AA seqDB search
MANIVLMLLLLHRLIFSSIAQETFDVRQHLSTVTRYEVSKGIKENAFDSSKIPDQCSPIH
LNLVARHGTRAPTKKRMRDLEILSVQLKSLMQNAKEKGYSLEKLPSWLTGWSSPWKGKTK
GGELIMHGEDEMYNLGIRIRERFQELFSDDYHPDVYQIRATQIPRASASAVAFGMGMFSG
RGKIGAGNHRAFAVLSESRASDIMLRFHDCCQNYKVHRKQQEPAVFKLKEPVLDEITRSL
AARYELNFTIKDTSTLWFLCKQEASLLDITNQACGLFSNDEVNLLEWTDDLEMFILKGYG
KSLNYRMGVPLLEDVISSMEAAIKAKEEGYASGSYEKARLRFAHAETLVPFSCLIGLFLD
GSEFDQIQKEKPLEYPLKPPQKRTWRGSTVAPFAGNNALVLYSCPENNTSKYFLQVLHNE
QPIPMAGCGGTDFCPFQIFKEKIAAAHLKHSYDYLCNASMEKQPGSKSFVSQLFEMLSWI
LSGKNKDKASPKVEL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatatagttttaatgctactgcttttgcatcgtctcattttttcttcaatcgct
caagaaacctttgacgttcgtcaacacctgtctaccgtaacaagatacgaggtctcaaaa
ggcatcaaagaaaacgcttttgattcttcgaaaattcctgaccaatgttcgccgatccac
ctaaatcttgtggcaagacatggaacacgtgcacctacgaagaaaagaatgagagacttg
gaaattttatccgttcagttaaaatcccttatgcaaaatgcaaaagaaaaaggttactct
ttggagaaacttccttcctggttaacgggatggagttcaccttggaaggggaaaaccaaa
ggtggagaattaataatgcacggagaagatgaaatgtataatcttggaatccgaatcagg
gaacggtttcaggaactgtttagtgatgattatcacccagacgtatatcagataagggca
acccagattccacgggcgtcagctagtgctgtagcgtttggcatggggatgtttagtggg
agaggaaaaattggagcgggaaatcatcgagcttttgcggttttgagtgaaagtcgtgca
agtgatataatgttgaggtttcatgattgttgccagaactataaggttcataggaaacaa
caggaacctgctgttttcaagcttaaagaacctgtattagatgaaattacccgttcatta
gcagcacgttatgaacttaatttcacaataaaggatacttccacactttggtttttatgc
aagcaggaagcatctttgctggacataactaatcaagcttgtggccttttcagtaacgat
gaggtaaatttgttagaatggacggatgatctggagatgttcatattaaagggctacggt
aaatcactaaattatcgaatgggagtgccgttgctggaagatgtcatttcgtctatggag
gccgccattaaagcgaaagaagaaggatacgcatccggcagttatgagaaggcgaggtta
cggtttgctcatgcagagacattagtccccttttcatgtttaatcgggctctttcttgac
ggatctgagtttgaccaaatacaaaaagaaaagcccttggaatatcccctaaaaccccca
cagaaaagaacatggaggggcagcacggtggctccttttgcgggaaataatgctttagtt
ttatatagctgtccggaaaataacacaagcaaatactttttgcaagtattacacaatgag
caaccaatcccaatggctggatgtgggggtactgatttctgtccattccaaatatttaag
gaaaaaatagcagctgcacacttgaagcacagctacgattacctatgtaatgccagcatg
gaaaaacagccaggaagtaagtcgtttgtgagccaattatttgaaatgctgagttggatt
ttatcgggaaagaacaaggataaggcgtctccaaaagtagagctgtaa

DBGET integrated database retrieval system