KEGG   Helianthus annuus (common sunflower): 110876087Help
Entry
110876087         CDS       T05101                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00052  Galactose metabolism
han00500  Starch and sucrose metabolism
han01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110876087
   00500 Starch and sucrose metabolism
    110876087
Enzymes [BR:han01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     110876087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Retrotran_gag_2
Motif
Other DBs
NCBI-GeneID: 110876087
NCBI-ProteinID: XP_021979959
AA seq 635 aa AA seqDB search
MQNFVAERGEGYAATTKIRQDQLKKKFESFRFLEKETLNDITNRYYHLMCEMRAFGVPTS
QQEMVARFADALPPKWGSFIEQLKHTGTLNTVNIYEFIEKLEHKNDQEIWKAKRALVPKN
TEMYLPGPMYYKGVYHFFYQHNPYGPLWGNMSWGHAISHDLINWVHLDIALVPNEHYDIN
GCFSGSATILPNGEPAILYTGVDAKLHQVQNLAFPKNISDPLLKEWVKWPLNPILSPPDE
IDPSFYRDPSTGWMGADGEWRVVIGSRIDHQGAAILYKSKDFRSWNRSLSPFPLSNITTF
WECPEFYPVISNGKSGLDTSVISVQGKDIKHVLKASFNDQDYYILGKYDPESDRYDVYAD
FMKSKEWLQYDYGKFYASKSFYDGEKKRRILWSWVSESDTAPDAIEKGWSGLQTIPRSIW
LSKNEDQLVQWPVKELEKLRTRKVHFKNKRLKGRSMIEISGITASQADVEITFRVSNLKH
AEVLSSEVVDPQILCTQKNATTDGKFGPFGLLVLASKNLTEHTAVFFRVFRIANSFRVLM
CADPSRSSLKPFIDKPIYGAFLALDPRYAKISLRTLIDHSIVESFGGEGLACITSRVYPV
LAVGEQAHLYAFNNGTKSLSISSLSAWSMKKAQIV
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgcagaattttgtggcagaaagaggagaaggatatgcagctactactaagatacgccag
gatcagttgaagaagaaattcgaatcatttcgtttcttagagaaagaaacactaaatgat
ataacgaatcgttattatcatttaatgtgtgaaatgcgtgcttttggtgttcctacatct
caacaggaaatggtggcacggtttgctgatgctctaccaccaaagtggggttcattcatc
gagcagctgaagcatacgggtactctgaatacagtcaacatctatgaattcattgagaag
ctggaacacaagaatgaccaagaaatctggaaagctaagcgagctcttgttcctaaaaac
acagaaatgtatttgcctggaccaatgtattacaagggggtctaccattttttctatcaa
cacaatccatatggtccactatggggtaacatgtcatggggtcatgccatatcacatgat
cttatcaactgggttcatcttgatattgctcttgtaccaaacgagcattacgatatcaat
gggtgcttttctggttcggcaacgatactaccaaatggtgaaccggcgatcctatacaca
ggtgttgatgccaaattacaccaagtgcaaaatttggcatttcccaaaaacatatcggac
ccgctactaaaagaatgggtaaaatggccacttaacccaatattgagtcctccagatgaa
attgatccatccttttatagagatccatcaactggttggatgggtgcggatggagaatgg
agggttgtgattggaagtcggattgatcatcaaggagcagctattctttacaaaagtaag
gattttcgcagttggaataggtctctgagcccgtttcccctttctaacataacaacattt
tgggaatgtcctgagttttatcctgttatttctaatgggaaaagcgggcttgatacatca
gttatatccgttcaagggaaggacattaagcatgttcttaaagctagttttaatgaccag
gattattatatactgggaaaatatgatccagaaagtgaccgctacgatgtttatgctgac
ttcatgaagagtaaagagtggttacagtatgattatgggaagttttatgcttcaaagtcg
ttttatgatggtgagaagaagagaaggatattatggtcatgggttagtgaaagtgatact
gcaccagatgctatcgaaaaaggttggtctggccttcagacgattcctaggagcatctgg
cttagtaaaaatgaagatcagttggtgcagtggcctgtcaaggaactagagaaactacga
acacgaaaagtgcatttcaagaataaaagactcaagggcaggtccatgattgaaatttct
ggtatcacagcttcacaggctgatgtagaaatcacatttagagtctcaaatctcaaacat
gctgaggtgttgagttctgaagtagttgatccccaaattctttgtacacaaaaaaatgct
acaacagatggcaaatttgggcctttcggtttgctggttttggcttcaaagaaccttact
gaacacactgcggtcttctttcgtgtctttagaattgctaacagtttccgagtgctcatg
tgtgctgacccaagcaggtcgtctttaaaaccatttatcgacaaacccatctatggagct
tttcttgcacttgatcctagatacgcaaagatctccttgagaaccttgatagatcactcc
attgtagaaagctttggtggagaagggttggcttgcattacatcaagagtttatccagta
ctggcagttggagaacaagcacatctttatgcattcaacaatggcactaagagtttgagt
atctcaagtttaagtgcttggagtatgaagaaagctcaaattgtctaa

DBGET integrated database retrieval system