KEGG   Helianthus annuus (common sunflower): 110878706Help
Entry
110878706         CDS       T05101                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PIX13
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:han01001]
    110878706
Enzymes [BR:han01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110878706
Protein kinases [BR:han01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110878706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 110878706
NCBI-ProteinID: XP_021982752
AA seq 379 aa AA seqDB search
MGNCIPSASASETTQSTISVNRSTNTKPSSTTGTSIGTSNGVGISGTSTSTGYSRFSEAA
SPAGEVLPAADLKVYTYSDLKACTRSFKSDMVLGVGGFGTVYKGWVDEKTLLPSKNGTGF
MVAIKKLNHESVQGFQEWQSEVNFLGRLSHPNVVKLLGYCREDRDLLLVYEFMQKGSLEN
HLFRRGSAVQPLSWNLRLKIAIGAARGLAFLHSSDDNVIYRDIKASNILLDGNYNAKISD
FGLAKLGPSGGVSHVTTRVMGTHGYAAPEYIATGHLYVKSDVYGFGVVLLELMTGLRALD
TKRPGPQTNLVEWAKPLLPNRKKLKTIMDARIEGQYSSKGAIMLAQVILHCLEQEPRKRP
AMKEVADILEQIYAIKVKT
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgggaaactgcataccttctgcttctgcttcagaaaccacccagtcaaccatctccgtc
aatcgaagcaccaacaccaaaccctcttccaccacagggacatcaattggaacgagcaat
ggtgtgggaatttcggggacgagtactagtaccggctatagccggttttcggaggcggcg
tcaccggccggagaggtgttgccggcggcggacttgaaggtgtacacgtattcggatttg
aaggcgtgtactagaagttttaagtctgatatggttttgggtgtggggggttttgggact
gtgtataaaggttgggttgatgaaaagactttgttgccctccaagaatgggactgggttt
atggtggctattaagaagttgaatcatgagagtgttcaagggtttcaggaatggcagtcc
gaagtgaacttcttgggacggctttctcatcctaacgtggtgaagcttcttgggtactgc
agggaagatagagaccttctacttgtatatgagtttatgcagaagggaagcttagaaaac
catctttttagacgaggttctgcagttcaaccactttcttggaatttacggcttaaaata
gccataggtgcagctcgggggctagcttttttacacagttccgatgacaacgtcatttac
agagatattaaggcctctaatatattgctcgatgggaactacaatgcaaaaatttcagat
tttgggttggcgaaactaggtccttcaggaggagtgtcacatgtaacaacaagggtgatg
gggacgcatggctatgctgctcctgagtacattgctacaggccatttgtacgtaaagagt
gacgtgtatggatttggggtcgtgctacttgaattgatgacgggtctacgagcacttgac
acaaaaaggcccggcccacagactaacctggtcgagtgggccaaaccgttgctcccaaac
aggaagaagttaaaaacaataatggatgcaaggatagaaggccaatactcaagtaaaggt
gcaataatgctagctcaagtcatccttcattgcctagaacaggaaccacgaaaacggccc
gccatgaaagaagtggcggatattttggagcagatatatgctatcaaggtcaaaacctaa

DBGET integrated database retrieval system