KEGG   Helianthus annuus (common sunflower): 110878716Help
Entry
110878716         CDS       T05101                                 

Definition
(RefSeq) receptor-like cytosolic serine/threonine-protein kinase RBK1
Organism
han  Helianthus annuus (common sunflower)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110878716
NCBI-ProteinID: XP_021982763
AA seq 451 aa AA seqDB search
MKGRRKISISLMKGESWKKSLKSPDKESECNETSDDQSSPRGVLEVSGSCSDSDKSQANG
DGDGATWRNLIDNLKRKSFRRFSMGPLVAGYELSRKGFVKKLGRNNSSDAAVNDYYMPKP
SWRNFTFHELAVATGGFSPDNLLGKGGHAEVYKGCLPDGQIVAVKKITKKEKKDEDRVGD
FLTELGIIAHINHPNAAKLIGFSSDNDLHLVLQFAPHGSLASVLHASEENLDWNTRFKIA
IGIAEGLKYLHYECNKRIIHRDITASNILLVDDYEPQISDFGLAKWLPERWAQQVVSPVE
GTFGYMAPEYFMHGVIDEKTDIFAFGVLLLELITGRCAVDSRRQSLVIWAKPLLEQGDVE
ELVDPRLGSAYEVNELKRAVMVASACIHHMPEMRPHMKRVVQLLTGEGGTMELRQNTFDG
RSIILDACDLEGYTSTTYLQDLNRHRQLIME
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtcgccggaaaatctccataagtttgatgaaaggagaaagctggaagaaatct
ttaaaaagcccagataaggaatccgaatgtaatgaaactagtgatgatcaatcgtctcca
cgtggtgtgttggaagtttctgggtcgtgttcagattccgataagtctcaggcgaacggc
gacggcgatggggcgacgtggaggaatttgatcgataatttgaaaaggaaatcgtttagg
aggttttcaatggggccgttggtggcgggatatgagctttcacggaaggggtttgtgaag
aaattgggacggaataatagctccgacgcggcggttaacgactattatatgccgaaaccg
tcgtggcggaatttcacgtttcatgaactcgcggtggctactggtggcttttctcccgac
aacttgctcggaaaaggcgggcacgcggaagtgtacaaaggatgcttacccgacggtcaa
atcgtggcagttaagaagataacaaagaaagagaaaaaagacgaagatagggttggggat
ttcttaaccgagcttgggatcattgcgcatatcaaccatccaaatgctgctaagttgatc
ggcttcagttccgataatgatttgcaccttgtgttacaattcgcgcctcatggtagcctt
gcaagtgtattacatgcttcagaagagaacttagattggaatacaaggtttaagattgct
attgggattgcagaaggtttgaagtatctccattacgaatgtaacaaacgtataattcat
cgcgatatcactgcctcgaacattttacttgtcgatgattatgaacctcaaatatcggat
ttcggtctagcaaaatggctccccgaaaggtgggctcaacaagtagtctcgcctgttgag
gggactttcggatatatggctccagagtatttcatgcatggagtaatcgatgaaaaaacc
gacatttttgctttcggcgttcttctactcgagcttatcacaggtcgttgtgcggttgat
tcacgtcgacaaagccttgtaatatgggcaaaaccattacttgagcaaggtgatgtcgag
gaacttgtcgatccacgactaggaagtgcatatgaagttaatgagctaaaacgggccgtt
atggttgcttctgcgtgtattcatcacatgcccgagatgcgcccacatatgaaacgagtg
gttcaactactaacaggagaaggtgggaccatggaattgagacaaaatacgtttgatggg
agatcgatcattttagatgcttgtgatttggaggggtatacgtctacaacgtatctacaa
gatctcaatcgtcatagacaactaattatggaatga

DBGET integrated database retrieval system